Result : A5D1C3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AP009389.1 |
| Organism | Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) |
| Left | 1882048 |
| Right | 1882257 |
| Strand | - |
| Nucleotide Sequence | ATGAACCAACCGTCTCTCGATGAGCTTTTAGAAAAGGTTGACAGCCGGTACACCCTGGTTGTGGTAGCTGCCAAACGGGCCAGGGAACTCACCGAGAGGGGAAAAACCAAGGCTGACGGGGCGGCTGTCATGAAGCCGGTAACAGCCGCCCTAATGGAAATTGCCCAGAACAAGGTGGGATACAAAAGGACCAGGTCAGGCATTAAATAG |
| Sequence | MNQPSLDELLEKVDSRYTLVVVAAKRARELTERGKTKADGAAVMKPVTAALMEIAQNKVGYKRTRSGIK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 18218977 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A5D1C3 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1654330 | 1654536 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 2 | 2131808 | 2132017 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 3 | 1100474 | 1100680 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 4 | 3053579 | 3053800 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 5 | 2487221 | 2487427 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 6 | 2259754 | 2259960 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 7 | 1796080 | 1796289 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 8 | 2150370 | 2150576 | - | NZ_CP036259.1 | Sporomusa termitida |
| 9 | 3206915 | 3207121 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 10 | 2340956 | 2341159 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 11 | 1859676 | 1859882 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 12 | 1294695 | 1294901 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 13 | 4044534 | 4044704 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 14 | 2146289 | 2146495 | - | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 15 | 1454763 | 1454969 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 16 | 1878097 | 1878273 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 17 | 2796438 | 2796644 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 18 | 1165395 | 1165607 | - | NZ_LR134375.1 | Veillonella dispar |
| 19 | 344254 | 344457 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 20 | 940570 | 940782 | + | NZ_LT906470.1 | Veillonella rodentium |
| 21 | 1210192 | 1210404 | - | NZ_LR778174.1 | Veillonella parvula |
| 22 | 1107260 | 1107472 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 23 | 3336406 | 3336612 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 24 | 2465936 | 2466142 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 25 | 1328796 | 1329005 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 26 | 1280488 | 1280694 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 27 | 3946079 | 3946291 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 28 | 4127981 | 4128187 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 29 | 4941252 | 4941458 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 30 | 3853622 | 3853834 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 31 | 1790295 | 1790501 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 32 | 1112365 | 1112535 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 33 | 677626 | 677829 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 34 | 593477 | 593665 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 35 | 331754 | 331951 | + | NZ_LT996885.1 | Dialister massiliensis |
| 36 | 844316 | 844519 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 37 | 2806623 | 2806829 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 38 | 1532155 | 1532370 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 39 | 2421907 | 2422128 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 40 | 1582314 | 1582499 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 41 | 1209239 | 1209460 | - | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 42 | 2301174 | 2301383 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 43 | 2274012 | 2274227 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 44 | 1160301 | 1160492 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 45 | 2615779 | 2615991 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 46 | 2911452 | 2911664 | - | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 47 | 1387550 | 1387765 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 48 | 1188301 | 1188501 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 49 | 274179 | 274379 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 50 | 2794404 | 2794604 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 51 | 636150 | 636350 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 52 | 2005959 | 2006171 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 53 | 1401133 | 1401336 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 54 | 1149527 | 1149712 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 55 | 1233344 | 1233529 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 56 | 2185099 | 2185299 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 57 | 995068 | 995244 | - | NZ_CP029476.1 | Lactobacillus apis |
| 58 | 795958 | 796182 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 59 | 1344722 | 1344931 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 60 | 3603015 | 3603188 | + | NZ_CP009285.1 | Paenibacillus borealis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03755.15 | 0.88 | 52 | 941.0 | same-strand | YicC-like family, N-terminal region |
| 2 | PF08340.13 | 0.88 | 52 | 941.0 | same-strand | Domain of unknown function (DUF1732) |
| 3 | PF04025.14 | 0.88 | 52 | 636.0 | same-strand | Domain of unknown function (DUF370) |
| 4 | PF00625.23 | 0.93 | 55 | 8 | same-strand | Guanylate kinase |
| 5 | PF13238.8 | 0.73 | 43 | 13 | same-strand | AAA domain |
| 6 | PF04127.17 | 0.86 | 51 | 18 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.88 | 52 | 18.5 | same-strand | Flavoprotein |
| 8 | PF18074.3 | 0.69 | 41 | 1300 | same-strand | Primosomal protein N C-terminal domain |
| 9 | PF17764.3 | 0.69 | 41 | 1300 | same-strand | 3'DNA-binding domain (3'BD) |
| 10 | PF04851.17 | 0.69 | 41 | 1299.5 | same-strand | Type III restriction enzyme, res subunit |
| 11 | PF00270.31 | 0.69 | 41 | 1299.5 | same-strand | DEAD/DEAH box helicase |
| 12 | PF18319.3 | 0.69 | 41 | 1300 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
++ More..