Protein Information |
Information Type | Description |
---|---|
Protein name | Probable lipopolysaccharide assembly protein A |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1292364 |
Right | 1292657 |
Strand | + |
Nucleotide Sequence | ATGATTAAATATATTTTAGGTATTGTGATCTTTATTGCTATTGTGTTAGTTGCAATTACCATTGGTGCGAATAACGATCAGATTATTACATTTAATTATATTGTGGCAGAAAGTCAGTTTCAGCTTTCAAGCCTCGTTGCTATTTTATTTGGGTTAGGTTTAATTCTTGGTTGGTTAATTACTGCTTTTTTCTATATTAAGTTAAAATTAAAAAATATGGCACTAGCTCGTCAAGTGAAACGTCAGACTTTACAAATCAATGAATTGACGACTACGCGCGATAAGGTCGTTTAA |
Sequence | MIKYILGIVIFIAIVLVAITIGANNDQIITFNYIVAESQFQLSSLVAILFGLGLILGWLITAFFYIKLKLKNMALARQVKRQTLQINELTTTRDKVV |
Source of smORF | Swiss-Prot |
Function | Involved in the assembly of lipopolysaccharide (LPS). {ECO:0000255|HAMAP-Rule:MF_01948}. |
Pubmed ID | 7542800 |
Domain | CDD:412952 |
Functional Category | Others |
Uniprot ID | P44129 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1222840 | 1223133 | + | NZ_CP009610.1 | Haemophilus influenzae |
2 | 1707585 | 1707878 | - | NZ_LS483429.1 | Haemophilus aegyptius |
3 | 1754491 | 1754784 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
4 | 587994 | 588293 | - | NZ_CP040863.1 | Rodentibacter heylii |
5 | 1138104 | 1138400 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
6 | 645483 | 645779 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
7 | 462685 | 462984 | + | NZ_LT906448.1 | Pasteurella dagmatis |
8 | 1112892 | 1113188 | + | NZ_LR134167.1 | Avibacterium volantium |
9 | 1862353 | 1862649 | + | NZ_CP028926.1 | Pasteurella multocida |
10 | 1432385 | 1432678 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
11 | 706153 | 706443 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
12 | 682464 | 682754 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
13 | 1569873 | 1570160 | + | NZ_CP015029.1 | Frederiksenia canicola |
14 | 1091384 | 1091680 | - | NZ_CP015031.1 | Basfia succiniciproducens |
15 | 1465167 | 1465463 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
16 | 1149573 | 1149860 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
17 | 1588474 | 1588758 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
18 | 1212161 | 1212445 | - | NZ_CP016180.1 | Pasteurella skyensis |
19 | 856136 | 856426 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
20 | 1231512 | 1231799 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
21 | 1001406 | 1001693 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
22 | 1242049 | 1242321 | - | NZ_CP016604.1 | Otariodibacter oris |
23 | 1518825 | 1519112 | + | NZ_CP061280.1 | Mannheimia bovis |
24 | 1492984 | 1493271 | + | NZ_CP055305.1 | Mannheimia pernigra |
25 | 1332060 | 1332347 | + | NZ_CP046531.1 | Mannheimia ovis |
26 | 358529 | 358840 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
27 | 491580 | 491879 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
28 | 32022 | 32309 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
29 | 1009667 | 1009951 | + | NZ_CP018804.1 | Histophilus somni |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02224.20 | 1.0 | 29 | 2193 | same-strand | Cytidylate kinase |
2 | PF13238.8 | 0.93 | 27 | 2192 | same-strand | AAA domain |
3 | PF00575.25 | 1.0 | 29 | 450.0 | same-strand | S1 RNA binding domain |
4 | PF00216.23 | 1.0 | 29 | 69 | same-strand | Bacterial DNA-binding protein |
5 | PF18073.3 | 1.0 | 29 | 0 | same-strand | Rubredoxin metal binding domain |
6 | PF00215.26 | 0.9 | 26 | 1214.0 | same-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
7 | PF01253.24 | 0.9 | 26 | 1928.5 | same-strand | Translation initiation factor SUI1 |