Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_1128 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1195672 |
Right | 1195848 |
Strand | + |
Nucleotide Sequence | GTGGTTTATCACAACAGTATGTGCACTTATTTGTTCTACAACAAAATTGGTTTCGGCTTAGATTATCAGCTTTCTGTGTATCTTGGTTTAGCAACAACCATCGTTTGTATCGTATTGTTCTTCACAATGCTTAAACCATTAGGTACGCGAGATGAAGAAGCTTATATAAATAATTAG |
Sequence | MVYHNSMCTYLFYNKIGFGLDYQLSVYLGLATTIVCIVLFFTMLKPLGTRDEEAYINN |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 7542800 |
Domain | |
Functional Category | Others |
Uniprot ID | P44115 |
ORF Length (Amino Acid) | 58 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1735128 | 1735274 | - | NZ_CP009610.1 | Haemophilus influenzae |
2 | 1173564 | 1173710 | + | NZ_LS483429.1 | Haemophilus aegyptius |
3 | 1073755 | 1073901 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
4 | 99241 | 99387 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
5 | 124509 | 124655 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
6 | 1464457 | 1464603 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
7 | 2387858 | 2388013 | + | NZ_CP040863.1 | Rodentibacter heylii |
8 | 980484 | 980645 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
9 | 220057 | 220248 | + | NZ_LT906448.1 | Pasteurella dagmatis |
10 | 812639 | 812797 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
11 | 2108967 | 2109128 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
12 | 946065 | 946220 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
13 | 1542153 | 1542341 | + | NZ_CP028926.1 | Pasteurella multocida |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08245.14 | 0.62 | 8 | 3939.0 | same-strand | Mur ligase middle domain |
2 | PF02875.23 | 0.62 | 8 | 3939.0 | same-strand | Mur ligase family, glutamate ligase domain |
3 | PF01225.27 | 0.62 | 8 | 3939.0 | same-strand | Mur ligase family, catalytic domain |
4 | PF00905.24 | 0.62 | 8 | 2101.0 | same-strand | Penicillin binding protein transpeptidase domain |
5 | PF03717.17 | 0.62 | 8 | 2101.0 | same-strand | Penicillin-binding Protein dimerisation domain |
6 | PF04999.15 | 0.62 | 8 | 1762.0 | same-strand | Cell division protein FtsL |
7 | PF01795.21 | 0.62 | 8 | 792.5 | same-strand | MraW methylase family |
8 | PF02381.20 | 0.62 | 8 | 239.0 | same-strand | MraZ protein, putative antitoxin-like |
9 | PF00528.24 | 0.69 | 9 | 3767.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
10 | PF00005.29 | 0.77 | 10 | 6158.5 | opposite-strand | ABC transporter |