Result : P44115
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1128 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1195672 |
| Right | 1195848 |
| Strand | + |
| Nucleotide Sequence | GTGGTTTATCACAACAGTATGTGCACTTATTTGTTCTACAACAAAATTGGTTTCGGCTTAGATTATCAGCTTTCTGTGTATCTTGGTTTAGCAACAACCATCGTTTGTATCGTATTGTTCTTCACAATGCTTAAACCATTAGGTACGCGAGATGAAGAAGCTTATATAAATAATTAG |
| Sequence | MVYHNSMCTYLFYNKIGFGLDYQLSVYLGLATTIVCIVLFFTMLKPLGTRDEEAYINN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44115 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1735128 | 1735274 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 1173564 | 1173710 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 1073755 | 1073901 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 99241 | 99387 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 5 | 124509 | 124655 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 6 | 1464457 | 1464603 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 7 | 2387858 | 2388013 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 8 | 980484 | 980645 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 9 | 220057 | 220248 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 10 | 812639 | 812797 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 11 | 2108967 | 2109128 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 12 | 946065 | 946220 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 13 | 1542153 | 1542341 | + | NZ_CP028926.1 | Pasteurella multocida |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08245.14 | 0.62 | 8 | 3939.0 | same-strand | Mur ligase middle domain |
| 2 | PF02875.23 | 0.62 | 8 | 3939.0 | same-strand | Mur ligase family, glutamate ligase domain |
| 3 | PF01225.27 | 0.62 | 8 | 3939.0 | same-strand | Mur ligase family, catalytic domain |
| 4 | PF00905.24 | 0.62 | 8 | 2101.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 5 | PF03717.17 | 0.62 | 8 | 2101.0 | same-strand | Penicillin-binding Protein dimerisation domain |
| 6 | PF04999.15 | 0.62 | 8 | 1762.0 | same-strand | Cell division protein FtsL |
| 7 | PF01795.21 | 0.62 | 8 | 792.5 | same-strand | MraW methylase family |
| 8 | PF02381.20 | 0.62 | 8 | 239.0 | same-strand | MraZ protein, putative antitoxin-like |
| 9 | PF00528.24 | 0.69 | 9 | 3767.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 10 | PF00005.29 | 0.77 | 10 | 6158.5 | opposite-strand | ABC transporter |
++ More..