Result : P44107
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_1063 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 1127423 |
| Right | 1127635 |
| Strand | - |
| Nucleotide Sequence | ATGGAACGCAAAGAATATAAGGTGTTTAAATCAGGTTTGAACTTCTTAGAAGGAATCGCAAATTGGATAGGAATTAAAAATCCTCAATTAACGCAAACAGAAGATTTATTTTCTAACGAGTCGGATAAAAATGACTTTGGATTGCAAAAACGAATTGATGAAAAATATCGTAAAGATGACGATCCAGCCATTGATATTCGTCCTAAACACTAG |
| Sequence | MERKEYKVFKSGLNFLEGIANWIGIKNPQLTQTEDLFSNESDKNDFGLQKRIDEKYRKDDDPAIDIRPKH |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44107 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1116641 | 1116853 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 1798799 | 1799020 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 200769 | 200960 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1264479 | 1264649 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 810748 | 810924 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 6 | 884559 | 884744 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 7 | 924859 | 925095 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 8 | 659626 | 659811 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 9 | 1533441 | 1533629 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 10 | 1913643 | 1913831 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 11 | 1262453 | 1262668 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 12 | 1839582 | 1839764 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 13 | 147840 | 148025 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 14 | 877338 | 877532 | - | NZ_LR134167.1 | Avibacterium volantium |
| 15 | 428130 | 428339 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040863.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00696.30 | 0.93 | 14 | 1500.0 | opposite-strand | Amino acid kinase family |
| 2 | PF01765.21 | 0.6 | 9 | 2329 | opposite-strand | Ribosome recycling factor |
| 3 | PF00889.21 | 0.6 | 9 | 120 | opposite-strand | Elongation factor TS |
| 4 | PF00318.22 | 0.6 | 9 | 1075 | opposite-strand | Ribosomal protein S2 |
++ More..