Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_1063 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 1127423 |
Right | 1127635 |
Strand | - |
Nucleotide Sequence | ATGGAACGCAAAGAATATAAGGTGTTTAAATCAGGTTTGAACTTCTTAGAAGGAATCGCAAATTGGATAGGAATTAAAAATCCTCAATTAACGCAAACAGAAGATTTATTTTCTAACGAGTCGGATAAAAATGACTTTGGATTGCAAAAACGAATTGATGAAAAATATCGTAAAGATGACGATCCAGCCATTGATATTCGTCCTAAACACTAG |
Sequence | MERKEYKVFKSGLNFLEGIANWIGIKNPQLTQTEDLFSNESDKNDFGLQKRIDEKYRKDDDPAIDIRPKH |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 7542800 |
Domain | |
Functional Category | Others |
Uniprot ID | P44107 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1116641 | 1116853 | - | NZ_LS483429.1 | Haemophilus aegyptius |
2 | 1798799 | 1799020 | + | NZ_CP009610.1 | Haemophilus influenzae |
3 | 200769 | 200960 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
4 | 1264479 | 1264649 | + | NZ_CP040863.1 | Rodentibacter heylii |
5 | 810748 | 810924 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
6 | 884559 | 884744 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
7 | 924859 | 925095 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
8 | 659626 | 659811 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
9 | 1533441 | 1533629 | + | NZ_CP015031.1 | Basfia succiniciproducens |
10 | 1913643 | 1913831 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
11 | 1262453 | 1262668 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
12 | 1839582 | 1839764 | + | NZ_CP015029.1 | Frederiksenia canicola |
13 | 147840 | 148025 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
14 | 877338 | 877532 | - | NZ_LR134167.1 | Avibacterium volantium |
15 | 428130 | 428339 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00696.30 | 0.93 | 14 | 1500.0 | opposite-strand | Amino acid kinase family |
2 | PF01765.21 | 0.6 | 9 | 2329 | opposite-strand | Ribosome recycling factor |
3 | PF00889.21 | 0.6 | 9 | 120 | opposite-strand | Elongation factor TS |
4 | PF00318.22 | 0.6 | 9 | 1075 | opposite-strand | Ribosomal protein S2 |