Result : P44073
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0908 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 961305 |
| Right | 961607 |
| Strand | + |
| Nucleotide Sequence | ATGATTTCAGGCACTGTCAAACCGAATTTTTGGTCGCGATTACTTTTAAGTATCATCGCAATTTTTGCTTTGCCTAACGCACAAAGTTTTGAAAATCAAAATAATACGGAAAATTATTCCTCAAGTGTTTCCATTCAACAAGCGTTAGAAACGGTAAAAGTTGCTCGTGAAGTGCAACGACAAGCCATTCCTCAACCTTCAATTTCCCGTCAAACTGAAAAACAACTTAAAATTCAACCGCACTTTTTTACTGAAGCGTTGAATATTAGCGCGCCAATTCGAGCAGGCCCCTTGCTTATTTAA |
| Sequence | MISGTVKPNFWSRLLLSIIAIFALPNAQSFENQNNTENYSSSVSIQQALETVKVAREVQRQAIPQPSISRQTEKQLKIQPHFFTEALNISAPIRAGPLLI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10818. Profile Description: Protein of unknown function (DUF2547). This bacterial family of proteins has no known function. |
| Pubmed ID | 7542800 |
| Domain | CDD:402445 |
| Functional Category | Others |
| Uniprot ID | P44073 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 93752 | 94054 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 97324 | 97626 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 856714 | 857016 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1906565 | 1906864 | + | NZ_CP040863.1 | Rodentibacter heylii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00293.30 | 1.0 | 4 | 2895.0 | same-strand | NUDIX domain |
| 2 | PF14815.8 | 1.0 | 4 | 2895.0 | same-strand | NUDIX domain |
| 3 | PF07517.16 | 1.0 | 4 | 125.0 | same-strand | SecA DEAD-like domain |
| 4 | PF07516.15 | 1.0 | 4 | 125.0 | same-strand | SecA Wing and Scaffold domain |
| 5 | PF01043.22 | 1.0 | 4 | 125.0 | same-strand | SecA preprotein cross-linking domain |
| 6 | PF02810.17 | 1.0 | 4 | 125.0 | same-strand | SEC-C motif |
| 7 | PF05258.14 | 1.0 | 4 | 78.5 | opposite-strand | Dna[CI] antecedent, DciA |
| 8 | PF00383.25 | 0.75 | 3 | 422 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 9 | PF14437.8 | 0.75 | 3 | 422 | same-strand | MafB19-like deaminase |
| 10 | PF00303.21 | 0.75 | 3 | 943 | same-strand | Thymidylate synthase |
| 11 | PF01790.20 | 0.75 | 3 | 1804 | same-strand | Prolipoprotein diacylglyceryl transferase |
| 12 | PF01925.21 | 0.75 | 3 | 2619 | same-strand | Sulfite exporter TauE/SafE |
++ More..