Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_0908 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 961305 |
Right | 961607 |
Strand | + |
Nucleotide Sequence | ATGATTTCAGGCACTGTCAAACCGAATTTTTGGTCGCGATTACTTTTAAGTATCATCGCAATTTTTGCTTTGCCTAACGCACAAAGTTTTGAAAATCAAAATAATACGGAAAATTATTCCTCAAGTGTTTCCATTCAACAAGCGTTAGAAACGGTAAAAGTTGCTCGTGAAGTGCAACGACAAGCCATTCCTCAACCTTCAATTTCCCGTCAAACTGAAAAACAACTTAAAATTCAACCGCACTTTTTTACTGAAGCGTTGAATATTAGCGCGCCAATTCGAGCAGGCCCCTTGCTTATTTAA |
Sequence | MISGTVKPNFWSRLLLSIIAIFALPNAQSFENQNNTENYSSSVSIQQALETVKVAREVQRQAIPQPSISRQTEKQLKIQPHFFTEALNISAPIRAGPLLI |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10818. Profile Description: Protein of unknown function (DUF2547). This bacterial family of proteins has no known function. |
Pubmed ID | 7542800 |
Domain | CDD:402445 |
Functional Category | Others |
Uniprot ID | P44073 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 93752 | 94054 | - | NZ_CP009610.1 | Haemophilus influenzae |
2 | 97324 | 97626 | - | NZ_LS483429.1 | Haemophilus aegyptius |
3 | 856714 | 857016 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
4 | 1906565 | 1906864 | + | NZ_CP040863.1 | Rodentibacter heylii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00293.30 | 1.0 | 4 | 2895.0 | same-strand | NUDIX domain |
2 | PF14815.8 | 1.0 | 4 | 2895.0 | same-strand | NUDIX domain |
3 | PF07517.16 | 1.0 | 4 | 125.0 | same-strand | SecA DEAD-like domain |
4 | PF07516.15 | 1.0 | 4 | 125.0 | same-strand | SecA Wing and Scaffold domain |
5 | PF01043.22 | 1.0 | 4 | 125.0 | same-strand | SecA preprotein cross-linking domain |
6 | PF02810.17 | 1.0 | 4 | 125.0 | same-strand | SEC-C motif |
7 | PF05258.14 | 1.0 | 4 | 78.5 | opposite-strand | Dna[CI] antecedent, DciA |
8 | PF00383.25 | 0.75 | 3 | 422 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
9 | PF14437.8 | 0.75 | 3 | 422 | same-strand | MafB19-like deaminase |
10 | PF00303.21 | 0.75 | 3 | 943 | same-strand | Thymidylate synthase |
11 | PF01790.20 | 0.75 | 3 | 1804 | same-strand | Prolipoprotein diacylglyceryl transferase |
12 | PF01925.21 | 0.75 | 3 | 2619 | same-strand | Sulfite exporter TauE/SafE |