ProsmORF-pred
Result : P44059
Protein Information
Information Type Description
Protein name Uncharacterized protein HI_0843
NCBI Accession ID L42023.1
Organism Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Left 892522
Right 892659
Strand +
Nucleotide Sequence ATGGTTCCTCTATGTGAAGGCGATTTATGGCAAGAATTAAGCCTATTAGCTGCTGGCTGCCGTTTCCCACACTTAGATGAAATGGTCAATATCGCAAGTATTAACGGTCGTAAAGTGTTAGGACTAGAGCTAATTTAG
Sequence MVPLCEGDLWQELSLLAAGCRFPHLDEMVNIASINGRKVLGLELI
Source of smORF Swiss-Prot
Function
Pubmed ID 7542800
Domain
Functional Category Others
Uniprot ID P44059
ORF Length (Amino Acid) 45
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 32
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 166676 166813 - NZ_LS483429.1 Haemophilus aegyptius
2 156593 156730 - NZ_CP009610.1 Haemophilus influenzae
3 907621 907758 - NZ_LS483458.1 Haemophilus haemolyticus
4 2113506 2113643 - NZ_CP040863.1 Rodentibacter heylii
5 1887162 1887296 - NC_006300.1 [Mannheimia] succiniciproducens MBEL55E
6 1506963 1507097 - NZ_CP015031.1 Basfia succiniciproducens
7 1513422 1513556 + NZ_LT906448.1 Pasteurella dagmatis
8 885374 885511 - NZ_LT906463.1 Haemophilus pittmaniae
9 199108 199242 + NZ_LR134167.1 Avibacterium volantium
10 1278529 1278663 - NZ_CP028926.1 Pasteurella multocida
11 251066 251200 - NZ_CP016605.1 Bisgaardia hudsonensis
12 304342 304473 - NZ_LS483443.1 Aggregatibacter segnis ATCC 33393
13 294590 294721 - NZ_LR134327.1 Aggregatibacter aphrophilus ATCC 33389
14 2088806 2088937 + NZ_CP046531.1 Mannheimia ovis
15 2117898 2118029 + NZ_CP055305.1 Mannheimia pernigra
16 179761 179892 - NZ_CP007715.1 Actinobacillus equuli subsp. equuli
17 193878 194009 - NZ_CP030753.1 Actinobacillus pleuropneumoniae
18 616963 617094 - NZ_CP006944.1 Mannheimia varigena USDA-ARS-USMARC-1312
19 204778 204909 - NZ_CP009159.1 Actinobacillus suis ATCC 33415
20 2022759 2022890 + NC_021883.1 Mannheimia haemolytica USMARC_2286
21 556297 556428 + NZ_CP006954.1 Bibersteinia trehalosi USDA-ARS-USMARC-188
22 2111444 2111575 + NZ_CP015029.1 Frederiksenia canicola
23 1142588 1142719 + NZ_CP029206.1 Actinobacillus porcitonsillarum
24 1644618 1644749 - NC_011852.1 Glaesserella parasuis SH0165
25 1002730 1002858 - NZ_CP061280.1 Mannheimia bovis
26 1170466 1170597 - NZ_CP015425.1 [Haemophilus] ducreyi
27 1610337 1610471 - NZ_CP016604.1 Otariodibacter oris
28 977347 977478 + NZ_CP040882.1 Sutterella faecalis
29 571284 571415 - NZ_CP068055.1 Sutterella wadsworthensis
30 2072984 2073115 + NZ_AP018786.1 Sutterella megalosphaeroides
31 1104590 1104724 - NZ_CP007445.1 Gilliamella apicola
32 1368572 1368700 - NZ_CP009056.1 Frischella perrara
++ More..