| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0704 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 749602 |
| Right | 749787 |
| Strand | + |
| Nucleotide Sequence | ATGAACAAATTAAGTCTTGTTTTAGTAGCTGGATTTCTTTTGGTTGGATGTGCATCTGAATCAGTTAAAGATCCAGACGCATTACCAAATGGCATTATGCAACCAGTAGAAGGCACTGGTGCCGTTGCTGGCGGTAGTTTTATGCCAGAAATTCAAAAAAATACGATACCAACACAAATGAAATAA |
| Sequence | MNKLSLVLVAGFLLVGCASESVKDPDALPNGIMQPVEGTGAVAGGSFMPEIQKNTIPTQMK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44040 |
| ORF Length (Amino Acid) | 61 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 334401 | 334586 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 461282 | 461467 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 521793 | 521978 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 297712 | 297897 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 5 | 1542331 | 1542522 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 6 | 1390188 | 1390376 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 7 | 421933 | 422121 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 8 | 1802607 | 1802771 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01551.24 | 1.0 | 8 | 20.5 | same-strand | Peptidase family M23 |
| 2 | PF01476.22 | 1.0 | 8 | 20.5 | same-strand | LysM domain |
| 3 | PF09335.13 | 1.0 | 8 | 13.0 | same-strand | SNARE associated Golgi protein |
| 4 | PF01975.19 | 1.0 | 8 | 617.5 | same-strand | Survival protein SurE |
| 5 | PF06877.13 | 0.62 | 5 | 2488 | opposite-strand | Regulator of ribonuclease activity B |