Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized HTH-type transcriptional regulator HI_0659 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 702730 |
Right | 703026 |
Strand | - |
Nucleotide Sequence | ATGAATAAAATCAGCCCATTAGGTTCAAATTGGAATGAGTTTGAACAGCAAATTTTCAATGAAGAAGAAATCCGAGAAAGTAATTTGCGTGTAGCCTTAATTAAAGAATTGATTACTTCTCGCCAGCAACTTGGGATTTCCCAAAAACAACTTGAAACCTTAAGCGGTGTGAAGCAACCTATGATTGCACGCATTGAAAAAGGACAAACGAATCCTCAGCTTGAAACGTTGTTAAAATTGCTCGCTCCTTTAGGGAAAACCCTGTCGATTGTTCCTCTAAGGGTAAAAAATGCCTAA |
Sequence | MNKISPLGSNWNEFEQQIFNEEEIRESNLRVALIKELITSRQQLGISQKQLETLSGVKQPMIARIEKGQTNPQLETLLKLLAPLGKTLSIVPLRVKNA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
Pubmed ID | 7542800 |
Domain | CDD:419869 |
Functional Category | DNA-binding |
Uniprot ID | P44030 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 377631 | 377927 | + | NZ_CP009610.1 | Haemophilus influenzae |
2 | 401397 | 401693 | + | NZ_LS483429.1 | Haemophilus aegyptius |
3 | 1588635 | 1588928 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
4 | 2430495 | 2430743 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
5 | 2367363 | 2367611 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
6 | 2041518 | 2041808 | + | NZ_CP014699.1 | Streptococcus pantholopis |
7 | 569663 | 569956 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
8 | 752461 | 752718 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
9 | 1325189 | 1325446 | + | NZ_CP032620.1 | Streptococcus koreensis |
10 | 1358547 | 1358807 | - | NZ_CP012805.1 | Streptococcus anginosus |
11 | 570475 | 570741 | - | NZ_CP016757.1 | Cloacibacillus porcorum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05973.16 | 0.73 | 8 | 23.0 | same-strand | Phage derived protein Gp49-like (DUF891) |