Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_0650 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 695381 |
Right | 695593 |
Strand | - |
Nucleotide Sequence | ATGATAAAAATCTTTATTTTTTTAACCGCACTTATCGTTTTATCTGGTTGTGGTTCCGTGGTCAAACTTATCGATCCAACAGAAAAATATACCGCCTATGCAGGGGTTGCTTATGATCTTGAAATGGCGCAACAATGGGGATTGCCAATCTTAGATTTGCCTCTCTCATTTTTATTAGACACTGTATTACTGCCCTATGCGTGGGCTCAATAA |
Sequence | MIKIFIFLTALIVLSGCGSVVKLIDPTEKYTAYAGVAYDLEMAQQWGLPILDLPLSFLLDTVLLPYAWAQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl11456. Profile Description: Protein of unknown function (DUF1375). hypothetical protein; Provisional |
Pubmed ID | 7542800 |
Domain | CDD:416280 |
Functional Category | Others |
Uniprot ID | P44028 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 409706 | 409918 | + | NZ_LS483429.1 | Haemophilus aegyptius |
2 | 385963 | 386175 | + | NZ_CP009610.1 | Haemophilus influenzae |
3 | 556437 | 556649 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
4 | 1792765 | 1792977 | + | NZ_CP040863.1 | Rodentibacter heylii |
5 | 605825 | 606046 | + | NZ_LR134167.1 | Avibacterium volantium |
6 | 335999 | 336211 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
7 | 500101 | 500307 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
8 | 29268 | 29489 | + | NZ_LT906448.1 | Pasteurella dagmatis |
9 | 440162 | 440392 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
10 | 186115 | 186315 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
11 | 349537 | 349758 | - | NZ_CP028926.1 | Pasteurella multocida |
12 | 381119 | 381334 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13361.8 | 1.0 | 12 | 6.0 | same-strand | UvrD-like helicase C-terminal domain |
2 | PF00580.23 | 1.0 | 12 | 6.0 | same-strand | UvrD/REP helicase N-terminal domain |
3 | PF13245.8 | 1.0 | 12 | 6.0 | same-strand | AAA domain |
4 | PF13538.8 | 1.0 | 12 | 6.0 | same-strand | UvrD-like helicase C-terminal domain |