Result : P44028
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0650 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 695381 |
| Right | 695593 |
| Strand | - |
| Nucleotide Sequence | ATGATAAAAATCTTTATTTTTTTAACCGCACTTATCGTTTTATCTGGTTGTGGTTCCGTGGTCAAACTTATCGATCCAACAGAAAAATATACCGCCTATGCAGGGGTTGCTTATGATCTTGAAATGGCGCAACAATGGGGATTGCCAATCTTAGATTTGCCTCTCTCATTTTTATTAGACACTGTATTACTGCCCTATGCGTGGGCTCAATAA |
| Sequence | MIKIFIFLTALIVLSGCGSVVKLIDPTEKYTAYAGVAYDLEMAQQWGLPILDLPLSFLLDTVLLPYAWAQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11456. Profile Description: Protein of unknown function (DUF1375). hypothetical protein; Provisional |
| Pubmed ID | 7542800 |
| Domain | CDD:416280 |
| Functional Category | Others |
| Uniprot ID | P44028 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 409706 | 409918 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 385963 | 386175 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 556437 | 556649 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1792765 | 1792977 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 605825 | 606046 | + | NZ_LR134167.1 | Avibacterium volantium |
| 6 | 335999 | 336211 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 7 | 500101 | 500307 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 8 | 29268 | 29489 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 9 | 440162 | 440392 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 10 | 186115 | 186315 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 11 | 349537 | 349758 | - | NZ_CP028926.1 | Pasteurella multocida |
| 12 | 381119 | 381334 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483429.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13361.8 | 1.0 | 12 | 6.0 | same-strand | UvrD-like helicase C-terminal domain |
| 2 | PF00580.23 | 1.0 | 12 | 6.0 | same-strand | UvrD/REP helicase N-terminal domain |
| 3 | PF13245.8 | 1.0 | 12 | 6.0 | same-strand | AAA domain |
| 4 | PF13538.8 | 1.0 | 12 | 6.0 | same-strand | UvrD-like helicase C-terminal domain |
++ More..