Result : P44017
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0577 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 596079 |
| Right | 596366 |
| Strand | + |
| Nucleotide Sequence | ATGCTTTATACATTTTCTCAATCAGATTATCCCAAAACTGAACTAGATGATTATTTTTCATATATTACAGAAAAAGATGCGGTAGTACTATGGCAAGACGGTGTGTTATTGGCAATAAAATATCCTGATTATTTTGCCAAATGTAAAGGGAATTGCATGATATTAAAACAAGATATTTTAGCAAGAAATCTCACCGCACTTTTACCTCAAAGCAGCAAGATAAAATTAATATCAATAGAAGAACTTGTTGGAATCACTGAAAATTATTTACCACAGCTATCACTATAA |
| Sequence | MLYTFSQSDYPKTELDDYFSYITEKDAVVLWQDGVLLAIKYPDYFAKCKGNCMILKQDILARNLTALLPQSSKIKLISIEELVGITENYLPQLSL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00672. Profile Description: DsrE/DsrF-like family. DsrE is a small soluble protein involved in intracellular sulfur reduction. The family also includes YrkE proteins. |
| Pubmed ID | 7542800 |
| Domain | CDD:412512 |
| Functional Category | Others |
| Uniprot ID | P44017 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 448810 | 449097 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 520257 | 520544 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 397760 | 398047 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 4 | 1359236 | 1359523 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 1304090 | 1304377 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 6 | 368553 | 368840 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 7 | 2010986 | 2011276 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 8 | 137536 | 137826 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 9 | 29311 | 29586 | + | NZ_CP016604.1 | Otariodibacter oris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02635.17 | 1.0 | 9 | 185.5 | same-strand | DsrE/DsrF-like family |
| 2 | PF08348.13 | 1.0 | 9 | 745 | same-strand | YheO-like PAS domain |
| 3 | PF13309.8 | 1.0 | 9 | 745 | same-strand | HTH domain |
| 4 | PF00254.30 | 1.0 | 9 | 1490 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 5 | PF01346.20 | 1.0 | 9 | 1490 | same-strand | Domain amino terminal to FKBP-type peptidyl-prolyl isomerase |
| 6 | PF04102.14 | 1.0 | 9 | 2322 | opposite-strand | SlyX |
++ More..