| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0476 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 498245 |
| Right | 498397 |
| Strand | + |
| Nucleotide Sequence | ATGGTAATTAAATGTATTGATAAACAACAAAATTTAGGAAATATCATTTTATTCCTTCTTCTTAAGCAACAATATAGCAAGGAAGATAGTAAAAAATTCACAATTTATAAATTTTATTTACAGACTGTAAATTATACAATACAATTATCGTAA |
| Sequence | MVIKCIDKQQNLGNIILFLLLKQQYSKEDSKKFTIYKFYLQTVNYTIQLS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P44002 |
| ORF Length (Amino Acid) | 50 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 543769 | 543921 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 617478 | 617630 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 1.0 | 2 | 3013.5 | opposite-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF00306.29 | 1.0 | 2 | 4151.0 | opposite-strand | ATP synthase alpha/beta chain, C terminal domain |
| 3 | PF02874.25 | 1.0 | 2 | 3013.5 | opposite-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 4 | PF00231.21 | 1.0 | 2 | 3266.0 | opposite-strand | ATP synthase |
| 5 | PF02823.18 | 1.0 | 2 | 1418.0 | opposite-strand | ATP synthase, Delta/Epsilon chain, beta-sandwich domain |
| 6 | PF03222.15 | 1.0 | 2 | 30.0 | same-strand | Tryptophan/tyrosine permease family |
| 7 | PF01502.20 | 1.0 | 2 | 82.0 | same-strand | Phosphoribosyl-AMP cyclohydrolase |
| 8 | PF01503.19 | 1.0 | 2 | 82.0 | same-strand | Phosphoribosyl-ATP pyrophosphohydrolase |
| 9 | PF00977.23 | 1.0 | 2 | 1126.0 | same-strand | Histidine biosynthesis protein |
| 10 | PF00117.30 | 1.0 | 2 | 2290.0 | same-strand | Glutamine amidotransferase class-I |
| 11 | PF01174.21 | 1.0 | 2 | 2290.0 | same-strand | SNO glutamine amidotransferase family |
| 12 | PF00475.20 | 1.0 | 2 | 2955.0 | same-strand | Imidazoleglycerol-phosphate dehydratase |