Result : P43998
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0451 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 473358 |
| Right | 473549 |
| Strand | - |
| Nucleotide Sequence | ATGGAACTAAGACAACAAATTCCAACAGGCTGTATTAAGCAATTCGGGCAATTTGGCGTGCCTTATGTGGTTGGCGAGGTTGCGGAATTTTTGCCAGATGGTGATGTGTTGGTGAATATCACATTGTTACAATCTGGTGAAAAAGACATTTATCGCTTATCTCACCTGCTTGAAGATCCCGAAGCTGAATAA |
| Sequence | MELRQQIPTGCIKQFGQFGVPYVVGEVAEFLPDGDVLVNITLLQSGEKDIYRLSHLLEDPEAE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17375. Profile Description: Family of unknown function (DUF5397). This is a family of unknown function found in Proteobacteria. |
| Pubmed ID | 7542800 |
| Domain | CDD:340090 |
| Functional Category | Others |
| Uniprot ID | P43998 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 572041 | 572232 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 1324141 | 1324341 | - | NZ_CP022278.1 | Neisseria chenwenguii |
| 3 | 10761 | 10955 | + | NZ_CP059568.1 | Kingella oralis |
| 4 | 16403 | 16594 | - | NZ_AP021883.1 | Sulfuriferula nivalis |
| 5 | 39202 | 39393 | + | NZ_AP021882.1 | Sulfuriferula nivalis |
| 6 | 1696032 | 1696223 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 7 | 3149733 | 3149924 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 8 | 30457 | 30651 | - | NC_015572.1 | Methylomonas methanica MC09 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09827.11 | 0.8 | 4 | 0 | same-strand | CRISPR associated protein Cas2 |
++ More..