Result : P43982

Protein Information

• Protein name: Uncharacterized protein HI_0310
• NCBI Accession ID: L42023.1
• Organism: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
• Left: 343715
• Right: 344002
• Strand: +
• Nucleotide Sequence: ATGAAAAAAATCACGCTTTTTTTTACCGCACTTTTATGCTTATTTTCAACTTCTGTTTTAGCCGAATCTAATTCAATACCTAAACAATGTGAACAACTATTTAAAGAAACAGAGAATTTGATTGCCCAAGCAGAAAAACAACCTGGAACCCACATTCAAGTAAATAAAATCAAAAGTAAACTAAACCAAAGCAAACAACAAATTCTTCAAATGGAATTAGCGACTCAGTTAAAAAGTTGTGAAGTGGGTTTAGCAAAATTAAGTAACTTGAAAAGTTATAGTGAGTAA
• Sequence: MKKITLFFTALLCLFSTSVLAESNSIPKQCEQLFKETENLIAQAEKQPGTHIQVNKIKSKLNQSKQQILQMELATQLKSCEVGLAKLSNLKSYSE
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam17274. Profile Description: Family of unknown function (DUF5339). This is a family of unknown function that can be found mostly in Proteobacteria. Some of the family members are predicted to contain a coiled coil region.
• Pubmed ID: 7542800
• Domain: CDD:407387
• Functional Category: Others
• Uniprot ID: P43982
• ORF Length (Amino Acid): 95

Conservation Analysis

No. of Species: 11

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	748553	748840	-	NZ_CP009610.1	Haemophilus influenzae
2	832465	832752	-	NZ_LS483429.1	Haemophilus aegyptius
3	934506	934790	-	NZ_LS483458.1	Haemophilus haemolyticus
4	1075677	1075991	-	NZ_LT906463.1	Haemophilus pittmaniae
5	128963	129286	-	NZ_LT906448.1	Pasteurella dagmatis
6	864922	865227	+	NZ_CP040863.1	Rodentibacter heylii
7	1927322	1927591	+	NZ_LS483443.1	Aggregatibacter segnis ATCC 33393
8	2169277	2169567	+	NZ_LR134327.1	Aggregatibacter aphrophilus ATCC 33389
9	2151730	2152035	+	NZ_LR134167.1	Avibacterium volantium
10	282707	283021	-	NZ_CP015031.1	Basfia succiniciproducens
11	664140	664454	-	NC_006300.1	[Mannheimia] succiniciproducens MBEL55E

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LS483458.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01709.22	0.91	10	2611.0	opposite-strand	Transcriptional regulator
2	PF02075.19	0.91	10	1758.5	opposite-strand	Crossover junction endodeoxyribonuclease RuvC
3	PF01330.23	0.91	10	1080.0	opposite-strand	RuvA N terminal domain
4	PF14520.8	0.91	10	1080.0	opposite-strand	Helix-hairpin-helix domain
5	PF07499.15	0.91	10	1080.0	opposite-strand	RuvA, C-terminal domain
6	PF05496.14	0.91	10	59.5	opposite-strand	Holliday junction DNA helicase RuvB P-loop domain
7	PF17864.3	0.91	10	59.5	opposite-strand	RuvB AAA lid domain
8	PF05491.15	0.91	10	59.5	opposite-strand	RuvB C-terminal winged helix domain
9	PF00004.31	0.91	10	59.5	opposite-strand	ATPase family associated with various cellular activities (AAA)
10	PF07728.16	0.91	10	59.5	opposite-strand	AAA domain (dynein-related subfamily)
11	PF01654.19	0.82	9	454	opposite-strand	Cytochrome bd terminal oxidase subunit I
12	PF02322.17	0.82	9	2033	opposite-strand	Cytochrome bd terminal oxidase subunit II
13	PF09600.12	0.73	8	3301.5	opposite-strand	Cyd operon protein YbgE (Cyd oper YbgE)
14	PF03061.24	0.82	9	3724	opposite-strand	Thioesterase superfamily
15	PF13279.8	0.82	9	3724	opposite-strand	Thioesterase-like superfamily