Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein HI_0310 |
NCBI Accession ID | L42023.1 |
Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
Left | 343715 |
Right | 344002 |
Strand | + |
Nucleotide Sequence | ATGAAAAAAATCACGCTTTTTTTTACCGCACTTTTATGCTTATTTTCAACTTCTGTTTTAGCCGAATCTAATTCAATACCTAAACAATGTGAACAACTATTTAAAGAAACAGAGAATTTGATTGCCCAAGCAGAAAAACAACCTGGAACCCACATTCAAGTAAATAAAATCAAAAGTAAACTAAACCAAAGCAAACAACAAATTCTTCAAATGGAATTAGCGACTCAGTTAAAAAGTTGTGAAGTGGGTTTAGCAAAATTAAGTAACTTGAAAAGTTATAGTGAGTAA |
Sequence | MKKITLFFTALLCLFSTSVLAESNSIPKQCEQLFKETENLIAQAEKQPGTHIQVNKIKSKLNQSKQQILQMELATQLKSCEVGLAKLSNLKSYSE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17274. Profile Description: Family of unknown function (DUF5339). This is a family of unknown function that can be found mostly in Proteobacteria. Some of the family members are predicted to contain a coiled coil region. |
Pubmed ID | 7542800 |
Domain | CDD:407387 |
Functional Category | Others |
Uniprot ID | P43982 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 748553 | 748840 | - | NZ_CP009610.1 | Haemophilus influenzae |
2 | 832465 | 832752 | - | NZ_LS483429.1 | Haemophilus aegyptius |
3 | 934506 | 934790 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
4 | 1075677 | 1075991 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
5 | 128963 | 129286 | - | NZ_LT906448.1 | Pasteurella dagmatis |
6 | 864922 | 865227 | + | NZ_CP040863.1 | Rodentibacter heylii |
7 | 1927322 | 1927591 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
8 | 2169277 | 2169567 | + | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
9 | 2151730 | 2152035 | + | NZ_LR134167.1 | Avibacterium volantium |
10 | 282707 | 283021 | - | NZ_CP015031.1 | Basfia succiniciproducens |
11 | 664140 | 664454 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01709.22 | 0.91 | 10 | 2611.0 | opposite-strand | Transcriptional regulator |
2 | PF02075.19 | 0.91 | 10 | 1758.5 | opposite-strand | Crossover junction endodeoxyribonuclease RuvC |
3 | PF01330.23 | 0.91 | 10 | 1080.0 | opposite-strand | RuvA N terminal domain |
4 | PF14520.8 | 0.91 | 10 | 1080.0 | opposite-strand | Helix-hairpin-helix domain |
5 | PF07499.15 | 0.91 | 10 | 1080.0 | opposite-strand | RuvA, C-terminal domain |
6 | PF05496.14 | 0.91 | 10 | 59.5 | opposite-strand | Holliday junction DNA helicase RuvB P-loop domain |
7 | PF17864.3 | 0.91 | 10 | 59.5 | opposite-strand | RuvB AAA lid domain |
8 | PF05491.15 | 0.91 | 10 | 59.5 | opposite-strand | RuvB C-terminal winged helix domain |
9 | PF00004.31 | 0.91 | 10 | 59.5 | opposite-strand | ATPase family associated with various cellular activities (AAA) |
10 | PF07728.16 | 0.91 | 10 | 59.5 | opposite-strand | AAA domain (dynein-related subfamily) |
11 | PF01654.19 | 0.82 | 9 | 454 | opposite-strand | Cytochrome bd terminal oxidase subunit I |
12 | PF02322.17 | 0.82 | 9 | 2033 | opposite-strand | Cytochrome bd terminal oxidase subunit II |
13 | PF09600.12 | 0.73 | 8 | 3301.5 | opposite-strand | Cyd operon protein YbgE (Cyd oper YbgE) |
14 | PF03061.24 | 0.82 | 9 | 3724 | opposite-strand | Thioesterase superfamily |
15 | PF13279.8 | 0.82 | 9 | 3724 | opposite-strand | Thioesterase-like superfamily |