| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0291 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 327506 |
| Right | 327712 |
| Strand | - |
| Nucleotide Sequence | ATGAAAACTATCACATTAAACATAAAAGGCATACATTGCGGCTGTTGCGTAAAAAATCTTACTCAAGTTTTAACTGAATTAGATGGTGTACAATCTGCTGATGTGCAATTAGAGGGTAAAGCAAATATTACTTTTGATGAAAATCGAGTCAATGTTGCACAGTTGATTGAGGTCATTGAAGATGCTGGATTTGACGCCACAGAGTAA |
| Sequence | MKTITLNIKGIHCGCCVKNLTQVLTELDGVQSADVQLEGKANITFDENRVNVAQLIEVIEDAGFDATE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00207. Profile Description: N/A. This model describes an apparently copper-specific subfamily of the metal-binding domain HMA (pfam00403). Closely related sequences outside this model include mercury resistance proteins and repeated domains of eukaryotic eukaryotic copper transport proteins. Members of this family are strictly prokaryotic. The model identifies both small proteins consisting of just this domain and N-terminal regions of cation (probably copper) transporting ATPases. [Transport and binding proteins, Cations and iron carrying compounds] |
| Pubmed ID | 7542800 10675023 |
| Domain | CDD:412222 |
| Functional Category | Metal-binding |
| Uniprot ID | P43979 |
| ORF Length (Amino Acid) | 68 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 764556 | 764762 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 764837 | 765043 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 765118 | 765324 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 4 | 765398 | 765604 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 5 | 845213 | 845419 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 6 | 848701 | 848907 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 7 | 848409 | 848615 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 8 | 2122660 | 2122866 | - | NZ_CP040863.1 | Rodentibacter heylii |
| 9 | 897836 | 898045 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 10 | 850979 | 851191 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 11 | 1551509 | 1551721 | - | NZ_CP047165.1 | Pelistega ratti |
| 12 | 1287123 | 1287335 | + | NZ_CP028926.1 | Pasteurella multocida |
| 13 | 1024890 | 1025105 | + | NZ_LR134365.1 | Cardiobacterium hominis |
| 14 | 16093 | 16305 | + | NZ_CP059565.1 | Neisseria wadsworthii |
| 15 | 1993409 | 1993621 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 16 | 2369598 | 2369810 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 17 | 2214877 | 2215092 | - | NZ_LR134533.1 | Neisseria weaveri |
| 18 | 1743895 | 1744110 | - | NZ_LT906434.1 | Neisseria zoodegmatis |
| 19 | 194571 | 194780 | + | NZ_CP031252.1 | Neisseria elongata |
| 20 | 414496 | 414705 | + | NZ_CP031252.1 | Neisseria elongata |
| 21 | 2092494 | 2092703 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 22 | 2433986 | 2434201 | + | NZ_LR134313.1 | Neisseria canis |
| 23 | 1961100 | 1961309 | + | NZ_CP031700.1 | Neisseria zalophi |
| 24 | 255837 | 256046 | - | NZ_CP038018.1 | Eikenella exigua |
| 25 | 959527 | 959736 | - | NZ_CP039886.1 | Neisseria flavescens |
| 26 | 937359 | 937568 | - | NZ_LS483369.1 | Neisseria cinerea |
| 27 | 1230160 | 1230369 | + | NZ_CP072524.1 | Neisseria sicca |
| 28 | 1117267 | 1117476 | + | NZ_CP072524.1 | Neisseria sicca |
| 29 | 42100 | 42312 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 30 | 667585 | 667794 | - | NZ_LR134516.1 | Neisseria animaloris |
| 31 | 430197 | 430406 | + | NZ_LT906482.1 | Eikenella corrodens |
| 32 | 1169852 | 1170058 | + | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 33 | 2013671 | 2013847 | + | NZ_CP014234.1 | Moraxella osloensis |
| 34 | 1032354 | 1032563 | - | NZ_CP039887.1 | Neisseria subflava |
| 35 | 173554 | 173763 | + | NZ_CP031699.1 | Neisseria animalis |
| 36 | 1512400 | 1512612 | - | NZ_CP059569.1 | Kingella oralis |
| 37 | 868461 | 868667 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00403.28 | 0.94 | 29 | 124.0 | same-strand | Heavy-metal-associated domain |
| 2 | PF00122.22 | 0.94 | 29 | 139 | same-strand | E1-E2 ATPase |
| 3 | PF00702.28 | 0.94 | 29 | 141.5 | same-strand | haloacid dehalogenase-like hydrolase |