Result : P43968
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0234 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 265270 |
| Right | 265416 |
| Strand | - |
| Nucleotide Sequence | GTGCGTAAAGTGGAGGATCAAATAAAAATTCAGCGTTCTTTTACAGAGTTAAATGAATTGTTCAAATTTTTAGGGGATTATTTTGATCCCGTCTCGATTGGTCTAGTCGGTGTGAAAATTGGAAACTTAGGGATAAAATTAGAATAA |
| Sequence | MRKVEDQIKIQRSFTELNELFKFLGDYFDPVSIGLVGVKIGNLGIKLE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P43968 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 914591 | 914737 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 2 | 827188 | 827334 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 3 | 58236 | 58409 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 4 | 318508 | 318672 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 5 | 2073594 | 2073728 | + | NZ_LR134167.1 | Avibacterium volantium |
| 6 | 2069889 | 2070020 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 7 | 1555725 | 1555847 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 8 | 1935381 | 1935503 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 9 | 589367 | 589486 | + | NZ_CP061280.1 | Mannheimia bovis |
| 10 | 2022826 | 2022945 | - | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 11 | 170543 | 170662 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 12 | 295693 | 295812 | - | NZ_CP046531.1 | Mannheimia ovis |
| 13 | 325418 | 325537 | - | NZ_CP055305.1 | Mannheimia pernigra |
| 14 | 1208273 | 1208410 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 15 | 226957 | 227094 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 16 | 1545305 | 1545424 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
++ More..