ProsmORF-pred
Result : P43967
Protein Information
Information Type Description
Protein name Uncharacterized protein HI_0233
NCBI Accession ID L42023.1
Organism Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Left 264984
Right 265136
Strand +
Nucleotide Sequence ATGTTAAAACGTAAAACTTTTCTTAAAAAGAAAGCTAATTTACAACAAAGTTCTTTATCACGTAATCTACGTTTAAGACGTTTAAAACACCGCAAACAACAACAATTTTCGAGACATTCATTACAATTTGTCGTACAAGAAATTTGTTGCTAA
Sequence MLKRKTFLKKKANLQQSSLSRNLRLRRLKHRKQQQFSRHSLQFVVQEICC
Source of smORF Swiss-Prot
Function
Pubmed ID 7542800
Domain
Functional Category Others
Uniprot ID P43967
ORF Length (Amino Acid) 50
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 9
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 914871 915023 - NZ_LS483429.1 Haemophilus aegyptius
2 827468 827620 - NZ_CP009610.1 Haemophilus influenzae
3 765135 765287 - NZ_LS483458.1 Haemophilus haemolyticus
4 1238322 1238471 + NZ_CP040863.1 Rodentibacter heylii
5 255358 255507 + NZ_LT906463.1 Haemophilus pittmaniae
6 977123 977275 - NZ_CP018804.1 Histophilus somni
7 1448055 1448201 + NZ_CP028926.1 Pasteurella multocida
8 2197215 2197349 - NZ_LR134167.1 Avibacterium volantium
9 308166 308312 + NZ_LT906448.1 Pasteurella dagmatis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LS483429.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01464.22 1.0 9 10 same-strand Transglycosylase SLT domain
2 PF00497.22 1.0 9 10 same-strand Bacterial extracellular solute-binding proteins, family 3
3 PF00270.31 0.78 7 1623 same-strand DEAD/DEAH box helicase
4 PF00271.33 0.78 7 1623 same-strand Helicase conserved C-terminal domain
5 PF03880.17 0.67 6 1597.0 same-strand DbpA RNA binding domain
6 PF01138.23 0.67 6 4558.0 same-strand 3' exoribonuclease family, domain 1
7 PF03726.16 0.67 6 4558.0 same-strand Polyribonucleotide nucleotidyltransferase, RNA binding domain
8 PF03725.17 0.67 6 4558.0 same-strand 3' exoribonuclease family, domain 2
9 PF00575.25 0.67 6 4558.0 same-strand S1 RNA binding domain
10 PF00013.31 0.67 6 4558.0 same-strand KH domain
++ More..