Result : P43964
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0210 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 225688 |
| Right | 225795 |
| Strand | + |
| Nucleotide Sequence | ATGAATTATTTCATCATGGATAAAACTTTCTTAGAACAAGAAATATTACTTCCCCAATTTATTATTCAAAATATAGAACGGTGGTTTAAAACACACAATTTTGTATAG |
| Sequence | MNYFIMDKTFLEQEILLPQFIIQNIERWFKTHNFV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7542800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P43964 |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 867833 | 867940 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 2 | 957066 | 957173 | - | NZ_LS483429.1 | Haemophilus aegyptius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP009610.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01432.22 | 1.0 | 2 | 3797.5 | same-strand | Peptidase family M3 |
| 2 | PF19310.1 | 1.0 | 2 | 3797.5 | same-strand | Neurolysin/Thimet oligopeptidase, N-terminal domain |
| 3 | PF04304.15 | 1.0 | 2 | 3316.5 | opposite-strand | Protein of unknown function (DUF454) |
| 4 | PF00496.24 | 1.0 | 2 | 1779.5 | opposite-strand | Bacterial extracellular solute-binding proteins, family 5 Middle |
| 5 | PF00925.22 | 1.0 | 2 | 813.5 | same-strand | GTP cyclohydrolase II |
| 6 | PF01569.23 | 1.0 | 2 | 16.0 | opposite-strand | PAP2 superfamily |
| 7 | PF14378.8 | 1.0 | 2 | 16.0 | opposite-strand | PAP2 superfamily |
| 8 | PF02086.17 | 1.0 | 2 | 964.5 | same-strand | D12 class N6 adenine-specific DNA methyltransferase |
| 9 | PF01761.22 | 1.0 | 2 | 1826.5 | same-strand | 3-dehydroquinate synthase |
| 10 | PF01202.24 | 1.0 | 2 | 2934.5 | same-strand | Shikimate kinase |
| 11 | PF13238.8 | 1.0 | 2 | 2934.5 | same-strand | AAA domain |
| 12 | PF02872.20 | 1.0 | 2 | 3761.0 | same-strand | 5'-nucleotidase, C-terminal domain |
| 13 | PF00149.30 | 1.0 | 2 | 3761.0 | same-strand | Calcineurin-like phosphoesterase |
++ More..