Result : P43960
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein HI_0173 |
| NCBI Accession ID | L42023.1 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Left | 186568 |
| Right | 186828 |
| Strand | + |
| Nucleotide Sequence | ATGCAAACTTTATTTTTTACTTTAATCGCTTTCGTCGCAATTATATTGTTGATGTCTATCGGATTTATTATCAAAAAACAAAGTTTAAAAGGCAGCTGCGGTGGTTTATCTACCCTTGGTATTGCCAAAGCTTGCGATTGTGATAAACCTTGCGACACGCATCATTCAAAATTAGATGCAGGCGATGAACAAGCGAAAGCTGAATATGAGCAAAAATTTGCGAAAAAAGATGATGACTCGCAATTTTATCAAGTGAAATAA |
| Sequence | MQTLFFTLIAFVAIILLMSIGFIIKKQSLKGSCGGLSTLGIAKACDCDKPCDTHHSKLDAGDEQAKAEYEQKFAKKDDDSQFYQVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01129. Profile Description: (Na+)-NQR maturation NqrM. The NqrM gene is often found adjacent to the nqr operons that encode (Na+)-NQR subunits. It is involved in the maturation of (Na+) translocating NADH:quinone oxidoreductase in proteobacteria. The four conserved Cys residues found in NqrM are required for (Na+)- NQR maturation and may serve as ligands for a metal ion or metal cluster used to build up the (Na+)-NQR molecule. |
| Pubmed ID | 7542800 |
| Domain | CDD:412759 |
| Functional Category | Others |
| Uniprot ID | P43960 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 17244 | 17504 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 2 | 994831 | 995091 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 3 | 906942 | 907202 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 4 | 1924931 | 1925191 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 5 | 1036797 | 1037057 | + | NZ_LT906463.1 | Haemophilus pittmaniae |
| 6 | 127104 | 127361 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 7 | 178382 | 178639 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 8 | 112076 | 112330 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 9 | 2116698 | 2116955 | - | NZ_CP015029.1 | Frederiksenia canicola |
| 10 | 2165779 | 2166033 | - | NZ_CP018804.1 | Histophilus somni |
| 11 | 1685639 | 1685896 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 12 | 748684 | 748938 | - | NZ_CP028926.1 | Pasteurella multocida |
| 13 | 1950035 | 1950289 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483458.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03054.18 | 1.0 | 13 | 231 | same-strand | tRNA methyl transferase |
| 2 | PF02424.17 | 1.0 | 13 | 10 | same-strand | ApbE family |
| 3 | PF00175.23 | 0.92 | 12 | 1215.0 | same-strand | Oxidoreductase NAD-binding domain |
| 4 | PF00111.29 | 0.92 | 12 | 1215.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 5 | PF02508.16 | 0.92 | 12 | 3018 | same-strand | Rnf-Nqr subunit, membrane protein |
| 6 | PF04205.16 | 0.77 | 10 | 3669.5 | same-strand | FMN-binding domain |
++ More..