Result : P43677
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Oxytetracycline polyketide synthase acyl carrier protein (ACP) |
| NCBI Accession ID | Z25538.1 |
| Organism | Streptomyces rimosus |
| Left | 2963 |
| Right | 3250 |
| Strand | + |
| Nucleotide Sequence | ATGACCCTGCTCACCCTCTCCGACCTGCTCACCCTGCTGCGCGAGTGCGCGGGCGAGGAGGAATCCATCGACCTGGGAGGGGACGTCGAGGACGTCGCCTTCGACGCCCTCGGCTACGACTCGCTGGCGCTGCTGAACACCGTGGGACGCATCGAGCGCGACTACGGGGTCCAGCTCGGGGACGACGCGGTGGAGAAGGCGACCACGCCGCGCGCCCTGATCGAGATGACCAACGCGTCGCTCACCGGCGCGTCCCCGTCCGCGGGTGGCGCCGCGCGGGACAAGTGA |
| Sequence | MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLGDDAVEKATTPRALIEMTNASLTGASPSAGGAARDK |
| Source of smORF | Swiss-Prot |
| Function | Acyl carrier protein. |
| Pubmed ID | 8163168 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | P43677 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 635869 | 636156 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 2 | 7822698 | 7822985 | - | NZ_CP023691.1 | Streptomyces platensis |
| 3 | 2650520 | 2650777 | - | NZ_CP023691.1 | Streptomyces platensis |
| 4 | 8198709 | 8198984 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 5 | 5789319 | 5789552 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 6 | 1903796 | 1904026 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 7 | 4682518 | 4682766 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 8 | 8199133 | 8199396 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 9 | 333197 | 333460 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 10 | 2612251 | 2612514 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 11 | 2594821 | 2595081 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 12 | 3077209 | 3077481 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 13 | 2366518 | 2366766 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 14 | 2866789 | 2867064 | - | NZ_CP029043.1 | Streptomyces nigra |
| 15 | 2118783 | 2119052 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 16 | 4209991 | 4210248 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 17 | 6364140 | 6364409 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 18 | 880170 | 880439 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 19 | 6186766 | 6187035 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 20 | 6345746 | 6346015 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 21 | 3956696 | 3956950 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 22 | 1043395 | 1043664 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 23 | 4119817 | 4120125 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 24 | 213078 | 213341 | + | NZ_CP030864.1 | Streptomyces globosus |
| 25 | 4690098 | 4690373 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 26 | 8141504 | 8141773 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 27 | 162168 | 162437 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 28 | 7690195 | 7690440 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 29 | 4859366 | 4859623 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 30 | 3259517 | 3259765 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 31 | 2186532 | 2186792 | + | NZ_CP070242.1 | Streptomyces californicus |
| 32 | 2173604 | 2173864 | + | NZ_CP020570.1 | Streptomyces violaceoruber |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00109.28 | 0.85 | 23 | 812.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 2 | PF02801.24 | 0.85 | 23 | 1218.0 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 3 | PF10604.11 | 0.67 | 18 | 902.5 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
++ More..