Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YczI |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 463245 |
Right | 463490 |
Strand | + |
Nucleotide Sequence | TTGTTTCGGATTTTTAAAATGTCTTTTGCGGTTATCATTATTATACTGGCGCTTATTGCTTTTAACTATACGGAACACACCTCTGTAATCCAATCGGTCATGCTCGTCTTTCTTGGTGCGGTCATGTTTATGCAGGGGCTTGAAGAGCGCAAAAAAGAAAATGACGGCTCAGGCGCTTTTAATATTTATACCGCCGTTTTTGTATGGTCTGTCTCCCTTATCGGTTTTACACTTCATATTATATAA |
Sequence | MFRIFKMSFAVIIIILALIAFNYTEHTSVIQSVMLVFLGAVMFMQGLEERKKENDGSGAFNIYTAVFVWSVSLIGFTLHII |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam13129. Profile Description: Protein of unknown function (DUF3953). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 47 and 76 amino acids in length. |
Pubmed ID | 8574415 8969502 9384377 |
Domain | CDD:404100 |
Functional Category | Others |
Uniprot ID | P42970 |
ORF Length (Amino Acid) | 81 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 415186 | 415431 | + | NZ_CP013984.1 | Bacillus inaquosorum |
2 | 463245 | 463490 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 617469 | 617714 | + | NZ_CP033052.1 | Bacillus vallismortis |
4 | 439283 | 439528 | + | NZ_CP048852.1 | Bacillus tequilensis |
5 | 460548 | 460793 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 460911 | 461156 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1548443 | 1548688 | - | NZ_CP029364.1 | Bacillus halotolerans |
8 | 3502261 | 3502506 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 451549 | 451794 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07286.14 | 1.0 | 9 | 3423 | same-strand | Protein of unknown function (DUF1445) |
2 | PF02682.18 | 1.0 | 9 | 2656 | same-strand | Carboxyltransferase domain, subdomain C and D |
3 | PF02626.17 | 1.0 | 9 | 1646 | same-strand | Carboxyltransferase domain, subdomain A and B |
4 | PF01614.20 | 1.0 | 9 | 877 | same-strand | Bacterial transcriptional regulator |
5 | PF09339.12 | 1.0 | 9 | 877 | same-strand | IclR helix-turn-helix domain |
6 | PF13412.8 | 0.67 | 6 | 878.5 | same-strand | Winged helix-turn-helix DNA-binding |
7 | PF13472.8 | 1.0 | 9 | 173 | same-strand | GDSL-like Lipase/Acylhydrolase family |
8 | PF00657.24 | 1.0 | 9 | 173 | same-strand | GDSL-like Lipase/Acylhydrolase |
9 | PF03992.18 | 1.0 | 9 | 3 | opposite-strand | Antibiotic biosynthesis monooxygenase |
10 | PF00905.24 | 1.0 | 9 | 445 | same-strand | Penicillin binding protein transpeptidase domain |
11 | PF05223.13 | 1.0 | 9 | 445 | same-strand | NTF2-like N-terminal transpeptidase domain |
12 | PF03717.17 | 1.0 | 9 | 445 | same-strand | Penicillin-binding Protein dimerisation domain |
13 | PF00248.23 | 0.89 | 8 | 2552.0 | same-strand | Aldo/keto reductase family |
14 | PF00874.22 | 1.0 | 9 | 3642 | same-strand | PRD domain |
15 | PF08279.14 | 1.0 | 9 | 3642 | same-strand | HTH domain |
16 | PF00359.24 | 1.0 | 9 | 3642 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
17 | PF02302.19 | 0.78 | 7 | 3643 | same-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
18 | PF00501.30 | 1.0 | 9 | 5937 | same-strand | AMP-binding enzyme |
19 | PF13193.8 | 1.0 | 9 | 5937 | same-strand | AMP-binding enzyme C-terminal domain |