Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YhaL |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 3255043 |
Right | 3255207 |
Strand | + |
Nucleotide Sequence | ATGAGTAAAAAATTGGCCAAAAAGCGCCAGCCGGTGAAGCCCGTGGTGGCGAAAGAACCTGCTCGCACCGCCAAAAATTTTGGCTATGAAGAGATGTTGAGCGAGCTGGAAGCTATCGTCGCGGATGCTGAAACGCGTTTAGCCGAGGATGAAGCTACCGCGTAA |
Sequence | MSKKLAKKRQPVKPVVAKEPARTAKNFGYEEMLSELEAIVADAETRLAEDEATA |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9278503 16738553 |
Domain | |
Functional Category | Others |
Uniprot ID | P42625 |
ORF Length (Amino Acid) | 54 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3255043 | 3255207 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 3994800 | 3994964 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 548498 | 548662 | - | NZ_CP061527.1 | Shigella dysenteriae |
4 | 3246470 | 3246634 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 3244429 | 3244593 | + | NZ_AP014857.1 | Escherichia albertii |
6 | 3768703 | 3768867 | + | NZ_LR134340.1 | Escherichia marmotae |
7 | 5013160 | 5013321 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
8 | 4168073 | 4168237 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
9 | 4028090 | 4028251 | - | NZ_CP038469.1 | Citrobacter tructae |
10 | 1263386 | 1263550 | + | NZ_CP053416.1 | Salmonella bongori |
11 | 2064328 | 2064477 | + | NZ_CP033744.1 | Citrobacter freundii |
12 | 3010852 | 3011001 | - | NZ_CP044098.1 | Citrobacter portucalensis |
13 | 5260394 | 5260555 | + | NZ_CP045205.1 | Citrobacter telavivensis |
14 | 1850306 | 1850467 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
15 | 2534321 | 2534473 | + | NZ_CP016337.1 | Kosakonia sacchari |
16 | 4282022 | 4282174 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
17 | 593901 | 594062 | - | NZ_CP050508.1 | Raoultella terrigena |
18 | 273406 | 273576 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
19 | 2151112 | 2151276 | + | NZ_CP057657.1 | Escherichia fergusonii |
20 | 638676 | 638834 | - | NZ_CP045845.1 | Kluyvera intermedia |
21 | 2287058 | 2287222 | - | NZ_CP042941.1 | Atlantibacter hermannii |
22 | 3997333 | 3997503 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13409.8 | 0.86 | 18 | 2337 | same-strand | Glutathione S-transferase, N-terminal domain |
2 | PF13410.8 | 0.86 | 18 | 2337 | same-strand | Glutathione S-transferase, C-terminal domain |
3 | PF05656.16 | 0.86 | 18 | 1782 | same-strand | Protein of unknown function (DUF805) |
4 | PF03466.22 | 0.9 | 19 | 829.5 | opposite-strand | LysR substrate binding domain |
5 | PF00126.29 | 0.95 | 20 | 829 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
6 | PF02678.18 | 0.95 | 20 | 24 | same-strand | Pirin |
7 | PF17954.3 | 0.95 | 20 | 24 | same-strand | Quercetinase C-terminal cupin domain |
8 | PF03313.17 | 0.76 | 16 | 328.5 | opposite-strand | Serine dehydratase alpha chain |
9 | PF03315.17 | 0.71 | 15 | 3152.5 | opposite-strand | Serine dehydratase beta chain |
10 | PF02901.17 | 0.62 | 13 | 4917.0 | opposite-strand | Pyruvate formate lyase-like |
11 | PF01228.23 | 0.62 | 13 | 4917.0 | opposite-strand | Glycine radical |
12 | PF07681.14 | 0.71 | 15 | 3321 | same-strand | DoxX |