Result : P42320

Protein Information

• Protein name: Uncharacterized protein YxiJ
• NCBI Accession ID: D83026.1
• Organism: Bacillus subtilis (strain 168)
• Left: 4155
• Right: 4451
• Strand: +
• Nucleotide Sequence: GTGCTTCAAAAACTGAGAAAAAGACAGCGAGAGCTTGAAGAAAAGCAGTACCCTGATGAATTGTACGGCTTTGAAGCGGAAATCTATGAGTTTTTTATGCTTGTTGCTGGCAGTTTGGATTATGTGCTGGCGAATAAAAGGATACCCCGGCATCAGCGGCGTTCGTTGGAGAAAAGCTTTTTTGAGCTGTATCCTGACATACTTCCGGATATGATCAAAAACGATAAGGATCTGTATCATCACATTCTCTTGTATGAACAAGTCAGACAAGAGATTTGCGTTGCGCTATCCAACTGA
• Sequence: MLQKLRKRQRELEEKQYPDELYGFEAEIYEFFMLVAGSLDYVLANKRIPRHQRRSLEKSFFELYPDILPDMIKNDKDLYHHILLYEQVRQEICVALSN
• Source of smORF: Swiss-Prot
• Pubmed ID: 8969509 9384377
• Functional Category: Others
• Uniprot ID: P42320
• ORF Length (Amino Acid): 98

Conservation Analysis

No. of Species: 7

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4019625	4019921	-	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	3840038	3840334	-	NZ_CP048852.1	Bacillus tequilensis
3	3910822	3911118	-	NZ_CP013984.1	Bacillus inaquosorum
4	2214488	2214784	+	NZ_CP029364.1	Bacillus halotolerans
5	3851390	3851686	-	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
6	3835136	3835432	-	NZ_CP051464.1	Bacillus mojavensis
7	3905034	3905330	-	NZ_CP033052.1	Bacillus vallismortis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP013984.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF10898.10	0.86	6	456.5	same-strand	Protein of unknown function (DUF2716)
2	PF11193.10	0.71	5	828	opposite-strand	Protein of unknown function (DUF2812)