| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YxiC |
| NCBI Accession ID | D31856.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 10544 |
| Right | 10813 |
| Strand | + |
| Nucleotide Sequence | ATGGCACAGGAAATTAAAATGGTGTATGACACAGTGAAGCAAGGGCTTTCTCAGCTCAAGAATTCAGCTGAACTCAAGTCCTCATTGCCCGGTCATCTCTCAGGCAGAAACCATTTGAATGTTGTGAAGTCCATCGAGCAATTAAATAAGGACATCAAAGAGCTCACTGAAGCATATGCGTCTGTTCTGGCCAAGCATATCGCACAAACGGAAAGCGCGGTAAACGCCATGAAGGAAACGGACGAAAACATATCATCTTCCATGAAATAA |
| Sequence | MAQEIKMVYDTVKQGLSQLKNSAELKSSLPGHLSGRNHLNVVKSIEQLNKDIKELTEAYASVLAKHIAQTESAVNAMKETDENISSSMK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17279. Profile Description: Family of unknown function (DUF5344). This is a Bacterial family of unknown function. Most of the members of this family are predicted to contain a coiled-coil region. |
| Pubmed ID | 7704263 9384377 |
| Domain | CDD:407392 |
| Functional Category | Others |
| Uniprot ID | P42295 |
| ORF Length (Amino Acid) | 89 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4038513 | 4038782 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3878255 | 3878524 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3929805 | 3930074 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3858504 | 3858773 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3857224 | 3857493 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 2201872 | 2202141 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3940403 | 3940672 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 490058 | 490336 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 434257 | 434535 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 475540 | 475818 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04740.14 | 1.0 | 10 | 20.0 | same-strand | LXG domain of WXG superfamily |
| 2 | PF14449.8 | 0.6 | 6 | 20.0 | same-strand | Pre-toxin TG |
| 3 | PF16888.7 | 1.0 | 10 | 12.0 | same-strand | Domain of unknown function (DUF5082) |