Result : A5CXC5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AP009247.1 |
| Organism | Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) |
| Left | 273788 |
| Right | 273997 |
| Strand | - |
| Nucleotide Sequence | ATGATGCCAGGACCATTTGAATTGATTATTATTTTAGTAATCGTGCTACTTCTTTTTGGTGGAAAACGATTAAAAGATATTGGTGGTGATTTAGGCAATGCCATTAAAGGCTTTAAAAAAGCCATGAAGGAATCAACAGATAGTATTAATAATAAAGACGATATTGTTGAAGCTAAAATTATTAAAAAAGAAATAAAACAAGAAAAATAA |
| Sequence | MMPGPFELIIILVIVLLLFGGKRLKDIGGDLGNAIKGFKKAMKESTDSINNKDDIVEAKIIKKEIKQEK |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 17493812 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A5CXC5 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 318316 | 318510 | - | NC_013456.1 | Vibrio antiquarius |
| 2 | 3159996 | 3160190 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 3 | 85061 | 85258 | + | NZ_CP030788.1 | Vibrio campbellii |
| 4 | 3012159 | 3012356 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 5 | 1719203 | 1719400 | - | NZ_CP019959.1 | Vibrio owensii |
| 6 | 309220 | 309417 | + | NZ_CP009467.1 | Vibrio harveyi |
| 7 | 2130446 | 2130643 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 8 | 3027400 | 3027597 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 9 | 351007 | 351180 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 10 | 3059271 | 3059456 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 11 | 249564 | 249749 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 12 | 75805 | 76011 | + | NZ_CP017280.1 | Enterobacter ludwigii |
| 13 | 4846912 | 4847118 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 14 | 2823609 | 2823809 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 15 | 4494565 | 4494771 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013456.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00490.23 | 0.73 | 11 | 2756 | same-strand | Delta-aminolevulinic acid dehydratase |
| 2 | PF01026.23 | 0.93 | 14 | 1607.0 | opposite-strand | TatD related DNase |
| 3 | PF00902.20 | 1.0 | 15 | 471 | same-strand | Sec-independent protein translocase protein (TatC) |
| 4 | PF03109.18 | 1.0 | 15 | 100 | same-strand | ABC1 atypical kinase-like domain |
| 5 | PF02036.19 | 1.0 | 15 | 1731 | same-strand | SCP-2 sterol transfer family |
| 6 | PF01209.20 | 1.0 | 15 | 2378 | same-strand | ubiE/COQ5 methyltransferase family |
| 7 | PF13649.8 | 1.0 | 15 | 2378 | same-strand | Methyltransferase domain |
| 8 | PF08241.14 | 1.0 | 15 | 2378 | same-strand | Methyltransferase domain |
| 9 | PF13847.8 | 0.87 | 13 | 2378 | same-strand | Methyltransferase domain |
| 10 | PF13489.8 | 1.0 | 15 | 2378 | same-strand | Methyltransferase domain |
| 11 | PF08242.14 | 1.0 | 15 | 2378 | same-strand | Methyltransferase domain |
| 12 | PF02646.18 | 0.93 | 14 | 3236.0 | same-strand | RmuC family |
| 13 | PF00892.22 | 0.67 | 10 | 4938.0 | opposite-strand | EamA-like transporter family |
++ More..