Result : P41792
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ethanolamine catabolic microcompartment shell protein EutN (Ethanolamine utilization protein EutN) |
| NCBI Accession ID | U18560.1 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Left | 1164 |
| Right | 1463 |
| Strand | + |
| Nucleotide Sequence | ATGGAGGCGGATATGAAACTGGCAGTCGTCACAGGACAAATCGTATGTACCGTCCGCCATCAGGGACTGGCGCATGACAAATTGCTGATGGTGGAAATGATCGATGCCCAGGGCAACCCCGACGGGCAGTGTGCCGTCGCTATCGACAGTATCGGGGCGGGAACCGGAGAGTGGGTACTGCTGGTCAGCGGCAGTTCCGCACGCCAGGCGCATCGCAGCGAATTATCACCGGTCGATCTGTGCGTCATTGGCATCGTCGATGAAGTGGTGGCTGGCGGGAAAGTGGTTTTCCATAAATAG |
| Sequence | MEADMKLAVVTGQIVCTVRHQGLAHDKLLMVEMIDAQGNPDGQCAVAIDSIGAGTGEWVLLVSGSSARQAHRSELSPVDLCVIGIVDEVVAGGKVVFHK |
| Source of smORF | Swiss-Prot |
| Function | May be involved in the formation of a specific microcompartment in the cell in which the metabolism of potentially toxic by-products takes place. {ECO:0000305|Pubmed:10464203, ECO:0000305|Pubmed:7868611}. |
| Pubmed ID | 7868611 10464203 11677609 |
| Domain | CDD:413110 |
| Functional Category | Others |
| Uniprot ID | P41792 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 543111 | 543410 | - | NZ_CP053416.1 | Salmonella bongori |
| 2 | 2574811 | 2575110 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 3 | 328472 | 328771 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 4 | 4792469 | 4792756 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 5 | 1995731 | 1996018 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 6 | 3848068 | 3848355 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 7 | 1252110 | 1252397 | - | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 3106386 | 3106685 | - | NZ_LR134340.1 | Escherichia marmotae |
| 9 | 4790985 | 4791272 | + | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 2571763 | 2572050 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 2526719 | 2527006 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 12 | 2539850 | 2540137 | - | NZ_AP014857.1 | Escherichia albertii |
| 13 | 3288094 | 3288381 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 14 | 3314123 | 3314410 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 15 | 1620272 | 1620559 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 16 | 1534948 | 1535235 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 17 | 3891406 | 3891666 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 18 | 1363136 | 1363396 | + | NZ_CP054254.1 | Klebsiella variicola |
| 19 | 626150 | 626398 | + | NZ_CP046293.1 | Yersinia intermedia |
| 20 | 4739483 | 4739770 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 21 | 1913590 | 1913838 | + | NZ_CP050150.1 | Hafnia alvei |
| 22 | 5930251 | 5930538 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 23 | 2148198 | 2148491 | + | NZ_CP029822.1 | Entomomonas moraniae |
| 24 | 700115 | 700399 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053416.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06277.13 | 1.0 | 23 | 4811.5 | same-strand | Ethanolamine utilisation protein EutA |
| 2 | PF04346.14 | 1.0 | 23 | 3580.5 | same-strand | Ethanolamine utilisation protein, EutH |
| 3 | PF00465.21 | 1.0 | 23 | 2256.0 | same-strand | Iron-containing alcohol dehydrogenase |
| 4 | PF14450.8 | 0.91 | 21 | 1426.0 | same-strand | Cell division protein FtsA |
| 5 | PF00171.24 | 0.83 | 19 | 12.0 | same-strand | Aldehyde dehydrogenase family |
| 6 | PF00936.21 | 1.0 | 23 | 115 | same-strand | BMC domain |
| 7 | PF01515.21 | 1.0 | 23 | 446.5 | same-strand | Phosphate acetyl/butaryl transferase |
| 8 | PF01923.20 | 1.0 | 23 | 1460 | same-strand | Cobalamin adenosyltransferase |
| 9 | PF06249.14 | 1.0 | 23 | 2270.5 | same-strand | Ethanolamine utilisation protein EutQ |
| 10 | PF10662.11 | 0.96 | 22 | 2937 | same-strand | Ethanolamine utilisation - propanediol utilisation |
++ More..