ProsmORF-pred
Result : P41065
Protein Information
Information Type Description
Protein name Protein TraR
NCBI Accession ID U01159.2
Organism Escherichia coli (strain K12)
Left 7344
Right 7565
Strand +
Nucleotide Sequence GTGAGTGATGAAGCCGATGAAGCATATTCAGTGACAGAACAACTGACCATGACAGGAATAAACCGGATACGCCAGAAAATAAATGCTCATGGTATTCCTGTTTATCTCTGTGAAGCATGCGGAAATCCTATTCCGGAAGCCCGGCGGAAAATATTTCCCGGTGTGACGTTGTGCGTTGAATGTCAGGCGTATCAGGAAAGACAGAGAAAACATTATGCATAA
Sequence MSDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVECQAYQERQRKHYA
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00755. Profile Description: Prokaryotic dksA/traR C4-type zinc finger. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General]
Pubmed ID 8021201 7915817 2265751
Domain CDD:412551
Functional Category Metal-binding
Uniprot ID P41065
ORF Length (Amino Acid) 73
++ More..