Result : P40819
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Orphan antitoxin YefM |
| NCBI Accession ID | AE006468.2 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Left | 3728313 |
| Right | 3728540 |
| Strand | - |
| Nucleotide Sequence | ATGTTTATGCGTACGGTTAACTATAGCGAAGCGCGGCAAAATCTGGCCGAAGTCCTGGAAAGTGCGGTGACGGGGGGGCCTGTTACCATCACGCGTCGTGGGCATAAGTCCGCAGTGATCATCAGCGCCGAGGAGTTTGAGCGTTATCAGACGGCGCGAATGGATGATGAGTTTGCTGCCATTATGGCGGTTCATGGCAATGAGCTCAGGGAGCTGGCGGATAAATGA |
| Sequence | MFMRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a toxin-antitoxin (TA) system; its cognate toxin is unknown. |
| Pubmed ID | 11677609 1429514 7920643 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P40819 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3728313 | 3728540 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4973321 | 4973542 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 3 | 310233 | 310454 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 4 | 327046 | 327267 | + | NZ_CP054254.1 | Klebsiella variicola |
| 5 | 2699447 | 2699659 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 6 | 4619509 | 4619730 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 7 | 4324422 | 4324634 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 8 | 4172375 | 4172587 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 9 | 1999708 | 1999929 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 10 | 4005865 | 4006086 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 11 | 2125975 | 2126196 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 12 | 56115 | 56366 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 13 | 4877514 | 4877735 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 14 | 51272 | 51493 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 15 | 4685673 | 4685894 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 16 | 237684 | 237905 | - | NZ_CP029185.2 | Limnobaculum parvum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.62 | 10 | 857.0 | same-strand | ABC transporter |
| 2 | PF17912.3 | 0.62 | 10 | 3766.5 | same-strand | MalK OB fold domain |
| 3 | PF08402.12 | 0.62 | 10 | 3766.5 | same-strand | TOBE domain |
| 4 | PF00528.24 | 0.62 | 10 | 2440.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 5 | PF13416.8 | 0.62 | 10 | 613.5 | same-strand | Bacterial extracellular solute-binding protein |
| 6 | PF01547.27 | 0.62 | 10 | 613.5 | same-strand | Bacterial extracellular solute-binding protein |
| 7 | PF12399.10 | 0.62 | 10 | 857.0 | same-strand | Branched-chain amino acid ATP-binding cassette transporter |
| 8 | PF02653.18 | 0.62 | 10 | 2298 | same-strand | Branched-chain amino acid transport system / permease component |
| 9 | PF11862.10 | 0.62 | 10 | 1621.0 | same-strand | Domain of unknown function (DUF3382) |
++ More..