Protein Information |
Information Type | Description |
---|---|
Protein name | Orphan antitoxin YefM |
NCBI Accession ID | AE006468.2 |
Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Left | 3728313 |
Right | 3728540 |
Strand | - |
Nucleotide Sequence | ATGTTTATGCGTACGGTTAACTATAGCGAAGCGCGGCAAAATCTGGCCGAAGTCCTGGAAAGTGCGGTGACGGGGGGGCCTGTTACCATCACGCGTCGTGGGCATAAGTCCGCAGTGATCATCAGCGCCGAGGAGTTTGAGCGTTATCAGACGGCGCGAATGGATGATGAGTTTGCTGCCATTATGGCGGTTCATGGCAATGAGCTCAGGGAGCTGGCGGATAAATGA |
Sequence | MFMRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK |
Source of smORF | Swiss-Prot |
Function | Putative antitoxin component of a toxin-antitoxin (TA) system; its cognate toxin is unknown. |
Pubmed ID | 11677609 1429514 7920643 |
Domain | CDD:415595 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P40819 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3728313 | 3728540 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 4973321 | 4973542 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
3 | 310233 | 310454 | + | NZ_LR134475.1 | Klebsiella aerogenes |
4 | 327046 | 327267 | + | NZ_CP054254.1 | Klebsiella variicola |
5 | 2699447 | 2699659 | + | NZ_CP044098.1 | Citrobacter portucalensis |
6 | 4619509 | 4619730 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
7 | 4324422 | 4324634 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
8 | 4172375 | 4172587 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
9 | 1999708 | 1999929 | + | NZ_CP042941.1 | Atlantibacter hermannii |
10 | 4005865 | 4006086 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
11 | 2125975 | 2126196 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
12 | 56115 | 56366 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
13 | 4877514 | 4877735 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
14 | 51272 | 51493 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
15 | 4685673 | 4685894 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
16 | 237684 | 237905 | - | NZ_CP029185.2 | Limnobaculum parvum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 0.62 | 10 | 857.0 | same-strand | ABC transporter |
2 | PF17912.3 | 0.62 | 10 | 3766.5 | same-strand | MalK OB fold domain |
3 | PF08402.12 | 0.62 | 10 | 3766.5 | same-strand | TOBE domain |
4 | PF00528.24 | 0.62 | 10 | 2440.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
5 | PF13416.8 | 0.62 | 10 | 613.5 | same-strand | Bacterial extracellular solute-binding protein |
6 | PF01547.27 | 0.62 | 10 | 613.5 | same-strand | Bacterial extracellular solute-binding protein |
7 | PF12399.10 | 0.62 | 10 | 857.0 | same-strand | Branched-chain amino acid ATP-binding cassette transporter |
8 | PF02653.18 | 0.62 | 10 | 2298 | same-strand | Branched-chain amino acid transport system / permease component |
9 | PF11862.10 | 0.62 | 10 | 1621.0 | same-strand | Domain of unknown function (DUF3382) |