Result : P40432
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 10.3 kDa protein in vnfA 5'region |
| NCBI Accession ID | M26752.1 |
| Organism | Azotobacter vinelandii |
| Left | 744 |
| Right | 1034 |
| Strand | + |
| Nucleotide Sequence | ATGTCCAATCCGCCGCTGGATACCGAGGAAAACGCAACCACCCTCGCGATAACGCCCATCCCCGCCGAATCCCTGCCGCTGGTGCGCGAAACCGTCGAGCGCCTGCGCCCGGGCGTGCAGCGCGACGGTGGCGACCTGGAGCTGGTCGCCGTACAGGACAACATCGTCCGCCTGCGCCTCAAGGGCGCCTGCGTCGGCTGCGCCATGTCCGCCCAGACGCTCGGCGGCGTGCGCCGCGAACTGGTCAAGGTGCTCGACAATCCCTCGGTGCGCGTACTGCCGGCCCCCTGA |
| Sequence | MSNPPLDTEENATTLAITPIPAESLPLVRETVERLRPGVQRDGGDLELVAVQDNIVRLRLKGACVGCAMSAQTLGGVRRELVKVLDNPSVRVLPAP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl29515. Profile Description: NifU-like domain. This is an alignment of the carboxy-terminal domain. This is the only common region between the NifU protein from nitrogen-fixing bacteria and rhodobacterial species. The biochemical function of NifU is unknown. |
| Pubmed ID | 2722750 |
| Domain | CDD:421844 |
| Functional Category | Others |
| Uniprot ID | P40432 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 263828 | 264118 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 2 | 4326162 | 4326452 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 3 | 782947 | 783243 | + | NZ_CP045302.1 | Azotobacter salinestris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012560.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00148.21 | 1.0 | 3 | 2562.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 2 | PF00158.28 | 1.0 | 3 | 28.5 | same-strand | Sigma-54 interaction domain |
| 3 | PF14532.8 | 1.0 | 3 | 28.5 | same-strand | Sigma-54 interaction domain |
| 4 | PF01590.28 | 1.0 | 3 | 28.5 | same-strand | GAF domain |
| 5 | PF02954.21 | 1.0 | 3 | 28.5 | same-strand | Bacterial regulatory protein, Fis family |
| 6 | PF13185.8 | 1.0 | 3 | 28.5 | same-strand | GAF domain |
| 7 | PF07728.16 | 1.0 | 3 | 28.5 | same-strand | AAA domain (dynein-related subfamily) |
| 8 | PF00004.31 | 1.0 | 3 | 28.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 9 | PF13492.8 | 1.0 | 3 | 28.5 | same-strand | GAF domain |
| 10 | PF01042.23 | 0.67 | 2 | 318.5 | same-strand | Endoribonuclease L-PSP |
| 11 | PF13328.8 | 0.67 | 2 | 751.0 | same-strand | HD domain |
| 12 | PF04607.19 | 0.67 | 2 | 751.0 | same-strand | Region found in RelA / SpoT proteins |
| 13 | PF02824.23 | 0.67 | 2 | 751.0 | same-strand | TGS domain |
| 14 | PF13291.8 | 0.67 | 2 | 751.0 | same-strand | ACT domain |
| 15 | PF01966.24 | 0.67 | 2 | 751.0 | same-strand | HD domain |
| 16 | PF01192.24 | 0.67 | 2 | 2927.5 | same-strand | RNA polymerase Rpb6 |
| 17 | PF00625.23 | 0.67 | 2 | 4093.0 | same-strand | Guanylate kinase |
| 18 | PF13671.8 | 0.67 | 2 | 4093.0 | same-strand | AAA domain |
++ More..