Result : P39809
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Negative regulator of flagellin synthesis (Anti-sigma-D factor) |
| NCBI Accession ID | L14437.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1328 |
| Right | 1594 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATCAATCAATTTGGAACACAATCCGTTAATCCATATCAAAAAAATTATGATAAGCAAGCGGTGCAAAAAACTGTTGCACAACCTCAAGATAAAATTGAAATTTCATCACAGGCTAAAGAAATGCAACATGCATCCGACGCAGTCACTGGTTCACGACAGGAAAAAATTGCGCAGCTTAAAGCGCAAATTGAAAACGGGTCATACAAAGTAGACGCAAATCATATTGCGAAAAATATGATTAATTTTTATAAAAAGCAATAA |
| Sequence | MKINQFGTQSVNPYQKNYDKQAVQKTVAQPQDKIEISSQAKEMQHASDAVTGSRQEKIAQLKAQIENGSYKVDANHIAKNMINFYKKQ |
| Source of smORF | Swiss-Prot |
| Function | Allows the coupling of early and late flagellar synthesis through the repression of RNA polymerase sigma-D factor-dependent transcription. |
| Pubmed ID | 8045879 8969505 9384377 |
| Domain | CDD:412716 |
| Functional Category | Others |
| Uniprot ID | P39809 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3640285 | 3640551 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3461582 | 3461848 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3502767 | 3503033 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3442573 | 3442839 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3496875 | 3497141 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3422409 | 3422675 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2615817 | 2616083 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 540768 | 541034 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3503615 | 3503881 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3606481 | 3606747 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3801044 | 3801310 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 4032257 | 4032523 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 2411275 | 2411538 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 14 | 2098790 | 2099053 | + | NZ_CP043404.1 | Bacillus safensis |
| 15 | 2159508 | 2159771 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 3199829 | 3200092 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 17 | 3185344 | 3185607 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02623.17 | 1.0 | 17 | 3591 | same-strand | FliW protein |
| 2 | PF20074.1 | 1.0 | 17 | 3004 | same-strand | Family of unknown function (DUF6470) |
| 3 | PF00669.22 | 1.0 | 17 | 2047 | same-strand | Bacterial flagellin N-terminal helical region |
| 4 | PF00700.23 | 1.0 | 17 | 2047 | same-strand | Bacterial flagellin C-terminal helical region |
| 5 | PF00460.22 | 1.0 | 17 | 517 | same-strand | Flagella basal body rod protein |
| 6 | PF05130.14 | 1.0 | 17 | 16 | same-strand | FlgN protein |
| 7 | PF10719.11 | 0.88 | 15 | 1258 | same-strand | Late competence development protein ComFB |
| 8 | PF00271.33 | 1.0 | 17 | 1600 | same-strand | Helicase conserved C-terminal domain |
| 9 | PF04851.17 | 1.0 | 17 | 1600 | same-strand | Type III restriction enzyme, res subunit |
| 10 | PF00270.31 | 1.0 | 17 | 1600 | same-strand | DEAD/DEAH box helicase |
| 11 | PF02645.18 | 1.0 | 17 | 3112 | same-strand | Uncharacterised protein, DegV family COG1307 |
++ More..