Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | AP009247.1 |
Organism | Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) |
Left | 324743 |
Right | 325030 |
Strand | + |
Nucleotide Sequence | ATGTCATTATCTGAAAATCAGGTAAGTCAAATTGCTCATCTAGCATGTTTATCATTAAATGAAGCACAACTTAAGGATAACACACAAAATTTAAATACTATTACTAGTTTATTTGAACAATTGGCTAATATTGAGATTGATGGTGTTGAACCAATGTTGCATCCATTACATATGTTCCAACGTCTTAGAGAAGATGTTGTTTCTGAGAAAGAGCAGTTAGCATTGTTTCAATCAATTGCGCCAAAAGTTAGGAATGGCTATTATTTAGTGCCTACTGTTATTAAATAG |
Sequence | MSLSENQVSQIAHLACLSLNEAQLKDNTQNLNTITSLFEQLANIEIDGVEPMLHPLHMFQRLREDVVSEKEQLALFQSIAPKVRNGYYLVPTVIK |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 17493812 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | A5CX64 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 759453 | 759740 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
2 | 2645168 | 2645455 | + | NC_017857.3 | Methylophaga nitratireducenticrescens |
3 | 1176502 | 1176789 | - | NZ_CP054205.1 | Pseudomonas rhodesiae |
4 | 4557863 | 4558150 | - | NZ_CP014262.1 | Pseudomonas corrugata |
5 | 1010750 | 1011037 | - | NZ_CP035088.1 | Pseudomonas viciae |
6 | 3128400 | 3128687 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
7 | 1054573 | 1054860 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
8 | 950307 | 950594 | - | NZ_CP027723.1 | Pseudomonas orientalis |
9 | 5679050 | 5679337 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
10 | 5101619 | 5101906 | + | NZ_CP070503.1 | Pseudomonas atacamensis |
11 | 2865348 | 2865635 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
12 | 1009948 | 1010235 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
13 | 1103758 | 1104045 | - | NZ_CP027756.1 | Pseudomonas synxantha |
14 | 954992 | 955279 | - | NZ_CP010896.1 | Pseudomonas simiae |
15 | 1006584 | 1006871 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
16 | 978236 | 978523 | - | NZ_CP023272.1 | Pseudomonas lurida |
17 | 1038860 | 1039147 | - | NZ_CP018420.1 | Pseudomonas veronii |
18 | 1008664 | 1008951 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
19 | 1022881 | 1023168 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
20 | 4161930 | 4162217 | + | NZ_CP014205.2 | Pseudomonas glycinae |
21 | 1047084 | 1047371 | - | NZ_CP062253.1 | Pseudomonas gozinkensis |
22 | 3118056 | 3118343 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02627.22 | 0.86 | 19 | 4555 | same-strand | Carboxymuconolactone decarboxylase family |
2 | PF01699.26 | 0.91 | 20 | 3496.5 | same-strand | Sodium/calcium exchanger protein |
3 | PF03330.20 | 0.91 | 20 | 3077.0 | same-strand | Lytic transglycolase |
4 | PF02934.17 | 0.95 | 21 | 1479 | same-strand | GatB/GatE catalytic domain |
5 | PF02637.20 | 0.95 | 21 | 1479 | same-strand | GatB domain |
6 | PF01425.23 | 1.0 | 22 | 17.0 | same-strand | Amidase |
7 | PF06723.15 | 1.0 | 22 | 212.0 | opposite-strand | MreB/Mbl protein |
8 | PF14450.8 | 0.95 | 21 | 212 | opposite-strand | Cell division protein FtsA |
9 | PF04085.16 | 1.0 | 22 | 1421.5 | opposite-strand | rod shape-determining protein MreC |
10 | PF04093.14 | 1.0 | 22 | 2513.0 | opposite-strand | rod shape-determining protein MreD |
11 | PF02545.16 | 0.91 | 20 | 3050.0 | opposite-strand | Maf-like protein |
12 | PF10150.11 | 0.91 | 20 | 3703.5 | opposite-strand | Ribonuclease E/G family |