Result : A0A385XJL2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YgdT |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2969330 |
| Right | 2969476 |
| Strand | - |
| Nucleotide Sequence | ATGTTATCCACAGAAAGCTGGGATAACTGTGAAAAACCTCCACTACTGTTTCCATTTACAGCCTTGACGTGCGACGAAACTCCAGTTTTTAGTGGTTCAGTGCTTAACTTAGTGGCACATTCTGTGGATAAATACGGCATTGGTTGA |
| Sequence | MLSTESWDNCEKPPLLFPFTALTCDETPVFSGSVLNLVAHSVDKYGIG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A0A385XJL2 |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3691857 | 3692003 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2892957 | 2893103 | - | NZ_AP014857.1 | Escherichia albertii |
| 3 | 2969330 | 2969476 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 782009 | 782155 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 2929691 | 2929837 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 3453211 | 3453357 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 4309198 | 4309344 | + | NZ_CP038469.1 | Citrobacter tructae |
| 8 | 3344200 | 3344319 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 9 | 3904871 | 3905017 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 3163055 | 3163201 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 1757267 | 1757386 | - | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 979090 | 979236 | - | NZ_CP053416.1 | Salmonella bongori |
| 13 | 907956 | 908117 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 14 | 3943216 | 3943335 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 15 | 995228 | 995347 | + | NZ_CP050508.1 | Raoultella terrigena |
| 16 | 4037901 | 4038020 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 17 | 179149 | 179268 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 18 | 961465 | 961584 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 19 | 892237 | 892356 | + | NZ_CP041247.1 | Raoultella electrica |
| 20 | 726431 | 726550 | - | NZ_CP026047.1 | Raoultella planticola |
| 21 | 896140 | 896259 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 22 | 1505699 | 1505818 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 23 | 4339495 | 4339614 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 24 | 908149 | 908268 | + | NZ_CP054254.1 | Klebsiella variicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07963.14 | 0.83 | 19 | 5217.0 | same-strand | Prokaryotic N-terminal methylation motif |
| 2 | PF00303.21 | 1.0 | 23 | 4240.0 | same-strand | Thymidylate synthase |
| 3 | PF01790.20 | 1.0 | 23 | 3358.0 | same-strand | Prolipoprotein diacylglyceryl transferase |
| 4 | PF02896.20 | 1.0 | 23 | 919.0 | same-strand | PEP-utilising enzyme, PEP-binding domain |
| 5 | PF05524.15 | 1.0 | 23 | 919.0 | same-strand | PEP-utilising enzyme, N-terminal |
| 6 | PF00391.25 | 1.0 | 23 | 919.0 | same-strand | PEP-utilising enzyme, mobile domain |
| 7 | PF01590.28 | 1.0 | 23 | 919.0 | same-strand | GAF domain |
| 8 | PF13185.8 | 1.0 | 23 | 919.0 | same-strand | GAF domain |
| 9 | PF13492.8 | 1.0 | 23 | 919.0 | same-strand | GAF domain |
| 10 | PF00293.30 | 1.0 | 23 | 376.0 | same-strand | NUDIX domain |
| 11 | PF02976.17 | 1.0 | 23 | 187.0 | opposite-strand | DNA mismatch repair enzyme MutH |
| 12 | PF03741.18 | 1.0 | 23 | 946.0 | opposite-strand | Integral membrane protein TerC family |
| 13 | PF06004.14 | 1.0 | 23 | 1795.5 | opposite-strand | Bacterial protein of unknown function (DUF903) |
| 14 | PF00248.23 | 0.96 | 22 | 2156 | opposite-strand | Aldo/keto reductase family |
| 15 | PF07690.18 | 0.87 | 20 | 3335 | same-strand | Major Facilitator Superfamily |
++ More..