Result : P39609
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwdA |
| NCBI Accession ID | X73124.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 55450 |
| Right | 55698 |
| Strand | + |
| Nucleotide Sequence | TTGAATATACATGAACAGAAGATAACACCGGAATGTTTGGAAAAGGCTGCTAACCAAGTTGAAGATAAGCGAGAAGAATATAAGGATGTGCTGCTTCAGCTGAAAAAAATGCTTGGCGGAACAACGCCGCACAGTGAAACGGCGGAAATTCTCACGCGGGCATATGAACAAATGAAGGAATATGCACTTTTTGTTCAGTCGATAGAAACATTTTTGAGGAAATCTGCAAACAATTTAAAAATCAAATAA |
| Sequence | MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKEYALFVQSIETFLRKSANNLKIK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7934828 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P39609 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3901868 | 3902116 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3787326 | 3787574 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3762629 | 3762877 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 3725844 | 3726092 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3724778 | 3725026 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3714248 | 3714496 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2337206 | 2337454 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 286938 | 287162 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3754976 | 3755200 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 4043446 | 4043712 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 3838131 | 3838361 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1849624 | 1849878 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1917210 | 1917464 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 3444662 | 3444916 | - | NZ_CP011150.1 | Bacillus altitudinis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00535.28 | 0.86 | 12 | 2642.5 | same-strand | Glycosyl transferase family 2 |
| 2 | PF08543.14 | 1.0 | 14 | 90.5 | opposite-strand | Phosphomethylpyrimidine kinase |
| 3 | PF00251.22 | 1.0 | 14 | 94.0 | same-strand | Glycosyl hydrolases family 32 N-terminal domain |
| 4 | PF02378.20 | 1.0 | 14 | 1537.5 | same-strand | Phosphotransferase system, EIIC |
| 5 | PF00367.22 | 1.0 | 14 | 1537.5 | same-strand | phosphotransferase system, EIIB |
| 6 | PF00874.22 | 0.93 | 13 | 3320 | same-strand | PRD domain |
| 7 | PF03123.17 | 0.93 | 13 | 3320 | same-strand | CAT RNA binding domain |
++ More..