Result : P39390
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjiS |
| NCBI Accession ID | U14003.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 262583 |
| Right | 262747 |
| Strand | + |
| Nucleotide Sequence | ATGGAATTTCACGAAAACAGAGCTAAAGCGCCGTTTATCGGCCTGGTGCAACTCTGGCAGGCGGTGAGGCGTTGGCGGCGGCAAATGCAGACCCGACGCGTGTTACAGCAGATGAGTGATGAGCGGTTGAAGGATATCGGGTTACGCAGGGAGGATGTGGAGTGA |
| Sequence | MEFHENRAKAPFIGLVQLWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23975. Profile Description: Domain of unknown function (DUF1127). This family is found in several hypothetical bacterial proteins. In some cases it represents it represents the C-terminal region whereas in others it represents the whole sequence. |
| Pubmed ID | 7610040 9278503 16738553 |
| Domain | CDD:420128 |
| Functional Category | Others |
| Uniprot ID | P39390 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4571751 | 4571915 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2193103 | 2193267 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 3669294 | 3669458 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 5435018 | 5435182 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2734223 | 2734387 | - | NZ_CP038469.1 | Citrobacter tructae |
| 6 | 1311655 | 1311819 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 7 | 418634 | 418798 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 3214419 | 3214583 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 1677642 | 1677806 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 3378693 | 3378857 | + | NZ_CP033744.1 | Citrobacter freundii |
| 11 | 620645 | 620809 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 12 | 5223831 | 5223995 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 13 | 648298 | 648462 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 14 | 541967 | 542128 | + | NC_015968.1 | Enterobacter soli |
| 15 | 2411333 | 2411497 | + | NZ_CP026047.1 | Raoultella planticola |
| 16 | 4568224 | 4568388 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 17 | 4826697 | 4826861 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 18 | 4032965 | 4033126 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 19 | 4540592 | 4540756 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 20 | 4859935 | 4860099 | - | NZ_CP054254.1 | Klebsiella variicola |
| 21 | 4581018 | 4581182 | - | NZ_CP041247.1 | Raoultella electrica |
| 22 | 4028967 | 4029131 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 23 | 3572513 | 3572677 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 24 | 3440005 | 3440169 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 25 | 5323809 | 5323973 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 26 | 4929777 | 4929941 | - | NZ_CP050508.1 | Raoultella terrigena |
| 27 | 574258 | 574419 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 28 | 586826 | 586987 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 29 | 2833085 | 2833249 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 30 | 607017 | 607181 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 31 | 587819 | 587980 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 32 | 3957966 | 3958133 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 33 | 3722678 | 3722839 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 34 | 1943425 | 1943586 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 35 | 4229752 | 4229913 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 36 | 698811 | 698972 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 37 | 4026336 | 4026500 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 38 | 5223162 | 5223329 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 39 | 4657058 | 4657222 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 40 | 4776051 | 4776215 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 41 | 903532 | 903705 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 42 | 653470 | 653631 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 43 | 2420410 | 2420571 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 44 | 434729 | 434893 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 45 | 2529394 | 2529558 | + | NZ_CP053416.1 | Salmonella bongori |
| 46 | 2429439 | 2429603 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 47 | 3992895 | 3993056 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 48 | 618655 | 618816 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 49 | 607996 | 608160 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 50 | 77365 | 77529 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00155.23 | 0.96 | 47 | 177 | opposite-strand | Aminotransferase class I and II |
| 2 | PF00392.23 | 0.96 | 47 | 177.0 | opposite-strand | Bacterial regulatory proteins, gntR family |
++ More..