Result : P39355
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein YjhE |
| NCBI Accession ID | |
| Organism | Escherichia coli (strain K12) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MLADELTIGPIRAVPMDITPKYVGIASGLMNAGSAVADIISPIAFGIIIDKTGNWSLPFYGSVALLVIGIFLTFFMRPDKSL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7610040 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P39355 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4506861 | 4507109 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3013988 | 3014206 | - | NZ_LS483470.1 | Leminorella richardii |
| 3 | 3275259 | 3275483 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 4 | 1112264 | 1112515 | - | NZ_CP017562.1 | Paraburkholderia sprentiae WSM5005 |
| 5 | 2597963 | 2598214 | + | NZ_CP066076.1 | Paraburkholderia ginsengisoli |
| 6 | 1108362 | 1108613 | + | NZ_CP049137.1 | Paraburkholderia tropica |
| 7 | 3416490 | 3416738 | + | NC_007511.1 | Burkholderia lata |
| 8 | 427986 | 428237 | + | NC_021289.1 | Caballeronia insecticola |
| 9 | 4005794 | 4006045 | + | NC_010581.1 | Beijerinckia indica subsp. indica ATCC 9039 |
| 10 | 4246987 | 4247238 | - | NZ_CP010310.2 | Pandoraea pulmonicola |
| 11 | 2939147 | 2939398 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 12 | 1829837 | 1830082 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 13 | 3675351 | 3675602 | - | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 14 | 4021807 | 4022052 | - | NZ_CP010897.2 | Pandoraea vervacti |
| 15 | 1364268 | 1364519 | + | NZ_LT906435.1 | Pandoraea sputorum |
| 16 | 4009654 | 4009905 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 17 | 3763539 | 3763787 | - | NC_023018.2 | Pandoraea pnomenusa |
| 18 | 23981 | 24232 | + | NZ_CP013235.1 | Collimonas arenae |
| 19 | 2338633 | 2338884 | + | NZ_CP047385.1 | Pandoraea fibrosis |
| 20 | 1674674 | 1674919 | + | NZ_CP013481.2 | Pandoraea apista |
| 21 | 1434850 | 1435101 | + | NZ_CP013480.3 | Pandoraea norimbergensis |
| 22 | 1482183 | 1482431 | + | NZ_CP002580.1 | Burkholderia plantarii |
| 23 | 1248331 | 1248582 | + | NC_010623.1 | Paraburkholderia phymatum STM815 |
| 24 | 62890 | 63141 | + | NZ_CP013236.1 | Collimonas pratensis |
| 25 | 2568634 | 2568882 | + | NZ_CP045236.1 | Burkholderia cepacia |
| 26 | 78981 | 79232 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 27 | 3250658 | 3250909 | - | NZ_CP031466.1 | Paraburkholderia caffeinilytica |
| 28 | 3333885 | 3334133 | - | NC_010676.1 | Paraburkholderia phytofirmans PsJN |
| 29 | 2882936 | 2883187 | - | NZ_CP026112.1 | Paraburkholderia terrae |
| 30 | 1371481 | 1371732 | - | NZ_CP015959.1 | Paraburkholderia caribensis |
| 31 | 658600 | 658851 | + | NZ_CP046911.1 | Paraburkholderia acidiphila |
| 32 | 2024267 | 2024518 | + | NZ_CP022990.1 | Paraburkholderia aromaticivorans |
| 33 | 1549745 | 1549987 | + | NZ_CP062804.1 | Cupriavidus basilensis |
| 34 | 2688606 | 2688857 | + | NZ_CP024935.1 | Paraburkholderia graminis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP017562.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02913.21 | 0.85 | 28 | 804.5 | same-strand | FAD linked oxidases, C-terminal domain |
| 2 | PF01565.25 | 0.85 | 28 | 804.5 | same-strand | FAD binding domain |
| 3 | PF13183.8 | 0.85 | 28 | 804.5 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF13534.8 | 0.85 | 28 | 804.5 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF07729.14 | 0.91 | 30 | 2635.5 | opposite-strand | FCD domain |
| 6 | PF00392.23 | 0.91 | 30 | 2635.5 | opposite-strand | Bacterial regulatory proteins, gntR family |
++ More..