Result : P39354
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative uncharacterized protein YjhD |
| NCBI Accession ID | |
| Organism | Escherichia coli (strain K12) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MNCETKQRTQFECIYFSQYWAKGDFIAKRAPIGQWEPYSEESLLGIIVTSVCRIKVAMLKPEPPRDPHIPLMGDFN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7610040 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P39354 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4506626 | 4506856 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 71152 | 71385 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
++ More..