Result : P39274
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjdJ |
| NCBI Accession ID | U14003.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 42913 |
| Right | 43185 |
| Strand | + |
| Nucleotide Sequence | ATGGAAATACGCGAAGGCCACAATAAATTTTACATTAATGACAAACAAGGCAAGCAAATCGCTGAAATTGTCTTTGTGCCGACCGGAGAGAATTTAGCGATTATCGAACATACCGATGTCGATGAAAGCCTGAAAGGGCAAGGGATTGGTAAACAGCTGGTTGCGAAAGTCGTGGAAAAAATGCGTCGGGAAAAACGAAAAATTATCCCATTATGCCCATTTGCGAAACATGAATTTGATAAAACGCGGGAGTATGATGATATTCGCAGTTGA |
| Sequence | MEIREGHNKFYINDKQGKQIAEIVFVPTGENLAIIEHTDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPLCPFAKHEFDKTREYDDIRS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl17182. Profile Description: N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule. |
| Pubmed ID | 7610040 9278503 16738553 |
| Domain | CDD:418431 |
| Functional Category | Others |
| Uniprot ID | P39274 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 71
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4352085 | 4352357 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4014070 | 4014342 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 5206662 | 5206934 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 378072 | 378344 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 4360295 | 4360567 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1489029 | 1489301 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 7 | 228510 | 228782 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 3205292 | 3205564 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 9 | 826575 | 826847 | + | NZ_CP041247.1 | Raoultella electrica |
| 10 | 835755 | 836027 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 11 | 4400171 | 4400443 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 12 | 801218 | 801490 | - | NZ_CP026047.1 | Raoultella planticola |
| 13 | 885552 | 885824 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 14 | 890223 | 890495 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 15 | 3828188 | 3828460 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 16 | 3824886 | 3825158 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 17 | 3450680 | 3450952 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 18 | 3771536 | 3771808 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 19 | 842160 | 842432 | + | NZ_CP054254.1 | Klebsiella variicola |
| 20 | 887723 | 887995 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 21 | 4279577 | 4279849 | + | NZ_CP038469.1 | Citrobacter tructae |
| 22 | 4014160 | 4014432 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 23 | 1565271 | 1565543 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 24 | 1789492 | 1789764 | - | NZ_CP033744.1 | Citrobacter freundii |
| 25 | 3310943 | 3311215 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 26 | 4300498 | 4300770 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 27 | 4131876 | 4132148 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 28 | 3985371 | 3985643 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 29 | 3935025 | 3935297 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 30 | 3963430 | 3963702 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 31 | 945069 | 945341 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 32 | 3921464 | 3921736 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 33 | 3825050 | 3825322 | - | NC_015968.1 | Enterobacter soli |
| 34 | 882722 | 882994 | + | NZ_CP050508.1 | Raoultella terrigena |
| 35 | 4556267 | 4556539 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 36 | 4563160 | 4563432 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 37 | 1032099 | 1032371 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 38 | 3074571 | 3074843 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 39 | 884390 | 884662 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 40 | 5084134 | 5084406 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 41 | 861341 | 861613 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 42 | 1851937 | 1852209 | - | NZ_CP050150.1 | Hafnia alvei |
| 43 | 3543594 | 3543866 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 44 | 957134 | 957406 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 45 | 1577887 | 1578105 | - | NZ_LR134531.1 | Pragia fontium |
| 46 | 2272444 | 2272662 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 47 | 3345862 | 3346140 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 48 | 4166366 | 4166644 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 49 | 4120340 | 4120558 | - | NZ_LR134494.1 | Serratia quinivorans |
| 50 | 4040477 | 4040740 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 51 | 4095486 | 4095704 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 52 | 4044039 | 4044257 | - | NZ_LT906479.1 | Serratia ficaria |
| 53 | 1062044 | 1062262 | + | NZ_CP071320.1 | Serratia ureilytica |
| 54 | 792743 | 793018 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 55 | 2238565 | 2238840 | + | NZ_CP029736.1 | Providencia rettgeri |
| 56 | 3780554 | 3780832 | + | NZ_CP048796.1 | Providencia vermicola |
| 57 | 3804749 | 3805027 | - | NZ_LS483422.1 | Providencia heimbachae |
| 58 | 734687 | 734959 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 59 | 181388 | 181666 | + | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 60 | 127440 | 127715 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 61 | 117522 | 117800 | + | NZ_LT906444.1 | Listeria welshimeri |
| 62 | 124030 | 124308 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 63 | 3144125 | 3144400 | - | NZ_CP016540.2 | Planococcus versutus |
| 64 | 128017 | 128259 | - | NZ_CP019962.1 | Eubacterium limosum |
| 65 | 3430967 | 3431209 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 66 | 622013 | 622255 | + | NC_014624.2 | Eubacterium callanderi |
| 67 | 392500 | 392775 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 68 | 1181965 | 1182237 | + | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 69 | 1373197 | 1373478 | - | NZ_CP032050.1 | Euzebyella marina |
| 70 | 8272985 | 8273230 | - | NZ_CP032157.1 | Paraflavitalea soli |
| 71 | 1964010 | 1964291 | - | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 72 | 1964198 | 1964473 | - | NZ_LT906470.1 | Veillonella rodentium |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06902.13 | 0.77 | 55 | 12.0 | same-strand | Divergent 4Fe-4S mono-cluster |
++ More..