Result : P39146

Protein Information

• Protein name: ComF operon protein 2
• NCBI Accession ID: Z18629.1
• Organism: Bacillus subtilis (strain 168)
• Left: 2403
• Right: 2699
• Strand: +
• Nucleotide Sequence: ATGCTTGTCAATTCAAAAGAAATCGTAATGAAAGAACTGCTCGACCGATATATGGACCAGCTTCATATGGCCTGTACTTGCCAAGTATGCCAAAACGATGTATTGGCACTTTCTTTAAACAAAGTGAGTCCATCCTACGTTACTGATTTTAAAAAGATCGCATATACGAAAGCTGAGCTGGTAGATAAACAAAAAAACACAGCAATGCTTGTCATTTTGGCTGAATCTGCTGCAGTAGTTTCAGAGAGTCCAAGCGATTTATGTCAAACGAAGCAGGAGGAGGCATTCATAAACTGA
• Sequence: MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPSYVTDFKKIAYTKAELVDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam10719. Profile Description: Late competence development protein ComFB. This family is conserved in bacteria. Some members, with three conserved cysteines, are annotated as late competence development protein ComFB.
• Pubmed ID: 8412657 8969505 9384377
• Domain: CDD:402383
• Functional Category: Others
• Uniprot ID: P39146
• ORF Length (Amino Acid): 98

Conservation Analysis

No. of Species: 16

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3641811	3642107	-	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	3504291	3504587	-	NZ_CP013984.1	Bacillus inaquosorum
3	3444098	3444394	-	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
4	3463107	3463403	-	NZ_CP048852.1	Bacillus tequilensis
5	3498398	3498694	-	NZ_CP033052.1	Bacillus vallismortis
6	2614262	2614558	+	NZ_CP029364.1	Bacillus halotolerans
7	3423935	3424231	-	NZ_CP051464.1	Bacillus mojavensis
8	539226	539510	+	NZ_CP011937.1	Bacillus velezensis
9	3505139	3505423	-	NZ_CP053376.1	Bacillus amyloliquefaciens
10	3607996	3608280	-	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
11	4033756	4034058	-	NZ_LT603683.1	Bacillus glycinifermentans
12	3802562	3802846	-	NZ_CP023665.1	Bacillus paralicheniformis
13	2097258	2097551	+	NZ_CP043404.1	Bacillus safensis
14	3201331	3201624	-	NZ_CP011150.1	Bacillus altitudinis
15	2157976	2158269	+	NZ_CP017786.1	Bacillus xiamenensis
16	1574917	1575192	+	NZ_CP017703.1	Aeribacillus pallidus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00460.22	1.0	16	2038.0	same-strand	Flagella basal body rod protein
2	PF05130.14	1.0	16	1539.0	same-strand	FlgN protein
3	PF04316.15	1.0	16	1258.0	same-strand	Anti-sigma-28 factor, FlgM
4	PF00271.33	1.0	16	59.0	same-strand	Helicase conserved C-terminal domain
5	PF04851.17	1.0	16	59.0	same-strand	Type III restriction enzyme, res subunit
6	PF00270.31	1.0	16	59.0	same-strand	DEAD/DEAH box helicase
7	PF02645.18	1.0	16	1558.5	same-strand	Uncharacterised protein, DegV family COG1307
8	PF00072.26	1.0	16	2501.5	same-strand	Response regulator receiver domain
9	PF00196.21	1.0	16	2501.5	same-strand	Bacterial regulatory proteins, luxR family
10	PF05384.13	1.0	16	3273.5	same-strand	Sensor protein DegS
11	PF07730.15	1.0	16	3273.5	same-strand	Histidine kinase
12	PF02518.28	1.0	16	3273.5	same-strand	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
13	PF01205.21	1.0	16	4649.5	opposite-strand	Uncharacterized protein family UPF0029
14	PF09186.13	1.0	16	4649.5	opposite-strand	Domain of unknown function (DUF1949)