Protein Information |
Information Type | Description |
---|---|
Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
NCBI Accession ID | AP009247.1 |
Organism | Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) |
Left | 461790 |
Right | 462014 |
Strand | + |
Nucleotide Sequence | ATGTCAGAAAAATTTAATTTTAACCAAGGTTTAATTGATTTAGAAAAAATTGTAAAAGCCATGGAATCTGGCGATTTAAGTCTCGAAGATTCGCTTAATCATTTTTCTAAAGGTGTTGAATTAACTAAACAATGTCAAAGTGCACTCAATAAGGCAGAACAAAAAATTTCCATGTTAACTGAACAAGACAACTATACGAACGAAAAACCACTAAAGAGATTATAA |
Sequence | MSEKFNFNQGLIDLEKIVKAMESGDLSLEDSLNHFSKGVELTKQCQSALNKAEQKISMLTEQDNYTNEKPLKRL |
Source of smORF | Swiss-Prot |
Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
Pubmed ID | 17493812 |
Domain | CDD:412547 |
Functional Category | Others |
Uniprot ID | A5CWU5 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5117002 | 5117247 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
2 | 722438 | 722620 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
3 | 719611 | 719856 | - | NZ_CP068034.2 | Pseudomonas syringae |
4 | 753503 | 753748 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
5 | 627239 | 627484 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
6 | 80891 | 81109 | - | NZ_CP025491.2 | Legionella sainthelensi |
7 | 5426259 | 5426501 | + | NZ_CP010896.1 | Pseudomonas simiae |
8 | 848474 | 848659 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
9 | 497545 | 497787 | - | NZ_CP012400.2 | Pseudomonas yamanorum |
10 | 4097506 | 4097742 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
11 | 3675247 | 3675501 | - | NZ_CP011412.1 | Sedimenticola thiotaurini |
12 | 2643851 | 2644081 | + | NZ_CP013742.1 | Legionella pneumophila |
13 | 916624 | 916866 | - | NZ_AP022642.1 | Pseudomonas otitidis |
14 | 955507 | 955737 | - | NZ_CP038254.1 | Legionella israelensis |
15 | 5134981 | 5135214 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
16 | 706804 | 706986 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
17 | 72010 | 72228 | + | NZ_LR134418.1 | Legionella adelaidensis |
18 | 2104130 | 2104363 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00348.19 | 1.0 | 18 | -3.0 | same-strand | Polyprenyl synthetase |