Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YpfB |
NCBI Accession ID | U11687.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 1489 |
Right | 1665 |
Strand | + |
Nucleotide Sequence | ATGAAAACATTTGAACGGCTGCTGATCAAATTATTGTTCATTCAGGCCATCATTTTACTTGGTGTCCAATTTCTTTTTCACTATCAGCATATTGAACCATACGTATCAAAAGTGATTCAATATGAAGGGGTGGATAAAATGGAGGAAAACAATAGGATTGAAACCTTCAAACATTAA |
Sequence | MKTFERLLIKLLFIQAIILLGVQFLFHYQHIEPYVSKVIQYEGVDKMEENNRIETFKH |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam17313. Profile Description: Family of unknown function (DUF5359). This is a family of unknown function found in Bacillales. Most of the family members are predicted to have one trans-membrane region. |
Pubmed ID | 8760912 9384377 |
Domain | CDD:407421 |
Functional Category | Others |
Uniprot ID | P38492 |
ORF Length (Amino Acid) | 58 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2396798 | 2396974 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2266101 | 2266277 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 2268900 | 2269076 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 2353995 | 2354171 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 3859643 | 3859819 | + | NZ_CP029364.1 | Bacillus halotolerans |
6 | 2205960 | 2206136 | - | NZ_CP013984.1 | Bacillus inaquosorum |
7 | 2194736 | 2194912 | - | NZ_CP051464.1 | Bacillus mojavensis |
8 | 1718847 | 1719023 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 2280923 | 2281099 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2469794 | 2469970 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
11 | 2367635 | 2367811 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 2095082 | 2095264 | - | NZ_CP011150.1 | Bacillus altitudinis |
13 | 3284659 | 3284841 | + | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 1725603 | 1725782 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
15 | 2591492 | 2591668 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
16 | 991611 | 991790 | + | NZ_CP014342.1 | Geobacillus subterraneus |
17 | 3193540 | 3193722 | + | NZ_CP043404.1 | Bacillus safensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14140.8 | 0.82 | 14 | 3240.0 | opposite-strand | YpzI-like protein |
2 | PF00575.25 | 1.0 | 17 | 985 | same-strand | S1 RNA binding domain |
3 | PF02224.20 | 1.0 | 17 | 79 | same-strand | Cytidylate kinase |
4 | PF13189.8 | 1.0 | 17 | 79 | same-strand | Cytidylate kinase-like family |
5 | PF13238.8 | 0.94 | 16 | 79.0 | same-strand | AAA domain |
6 | PF12945.9 | 0.82 | 14 | 46.5 | same-strand | Flagellar protein YcgR |
7 | PF07238.16 | 0.82 | 14 | 46.5 | same-strand | PilZ domain |
8 | PF14620.8 | 1.0 | 17 | 793 | same-strand | YpeB sporulation |
9 | PF07486.14 | 1.0 | 17 | 2180 | same-strand | Cell Wall Hydrolase |
10 | PF01471.20 | 1.0 | 17 | 2180 | same-strand | Putative peptidoglycan binding domain |
11 | PF13367.8 | 1.0 | 17 | 3226 | same-strand | PrsW family intramembrane metalloprotease |
12 | PF13738.8 | 0.88 | 15 | 4026 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
13 | PF07992.16 | 0.88 | 15 | 4026 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |