Result : P38394

Protein Information

• Protein name: Uncharacterized protein YdaE
• NCBI Accession ID: Z23096.1
• Organism: Escherichia coli (strain K12)
• Left: 890
• Right: 1007
• Strand: +
• Nucleotide Sequence: ATGACTAAGAAAATAAAATGTGCTTACCACCTTTGCAAAAAAGACGTTGAAGAAAGCAAAGCTATTGAAAGAATGCTTCACTTCATGCACGGGATTTTATCAAAAGACGAACCGAGAA
• Sequence: MTKKIKCAYHLCKKDVEESKAIERMLHFMHGILSKDEPRKYCSEACAEKDQMAHEL
• Source of smORF: Swiss-Prot
• Pubmed ID: 9097039 9278503 16738553 7508908 2649487
• Functional Category: Others
• Uniprot ID: P38394
• ORF Length (Amino Acid): 56

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2340028	2340198	+	NZ_LR134340.1	Escherichia marmotae
2	1417838	1418008	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	1927446	1927616	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
4	1416911	1417081	-	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LR134340.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01381.24	0.67	2	1735.5	same-strand	Helix-turn-helix
2	PF13560.8	0.67	2	1735.5	same-strand	Helix-turn-helix domain
3	PF07151.14	0.67	2	1148	same-strand	Protein of unknown function (DUF1391)
4	PF14163.8	0.67	2	540	opposite-strand	Super-infection exclusion protein B
5	PF06630.13	0.67	2	452	same-strand	Enterobacterial exodeoxyribonuclease VIII
6	PF12684.9	0.67	2	452	same-strand	PDDEXK-like domain of unknown function (DUF3799)
7	PF03837.16	0.67	2	3045	same-strand	RecT family
8	PF06688.13	0.67	2	4098	same-strand	Protein of unknown function (DUF1187)
9	PF06806.14	0.67	2	4386	same-strand	Putative excisionase (DUF1233)