Protein Information |
Information Type | Description |
---|---|
Protein name | Killing protein KilR (FtsZ inhibitor protein KilR) |
NCBI Accession ID | Z23096.1 |
Organism | Escherichia coli (strain K12) |
Left | 669 |
Right | 890 |
Strand | + |
Nucleotide Sequence | ATGATTGCACATCACTTCGGAACTGATGAAATACCACGTCAGTGTGTGACTCCTGGCGATTATGTTCTTCATGAAGGCCGGACATATATTGCCTCGGCAAACAATATTAAAAAGCGAAAACTATATATTCGTAACCTGACCACAAAAACATGCATTACTGACCGCATGATTAAAGTCTTCCTCGGTCGTGATGGTTTACCTGTAAAGGCGGAGTCATGGTGA |
Sequence | MIAHHFGTDEIPRQCVTPGDYVLHEGRTYIASANNIKKRKLYIRNLTTKTFITDRMIKVFLGRDGLPVKAESW |
Source of smORF | Swiss-Prot |
Function | Causes inhibition of cell division. At high levels of expression, can also abolish the rod shape of the cells. Division inhibition by KilR can be relieved by overexpression of the cell division protein FtsZ. {ECO:0000269|Pubmed:8752325}. |
Pubmed ID | 7508908 9097039 9278503 16738553 8752325 |
Domain | CDD:236900 |
Functional Category | Others |
Uniprot ID | P38393 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1418008 | 1418229 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 2339807 | 2340028 | + | NZ_LR134340.1 | Escherichia marmotae |
3 | 1927616 | 1927837 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 1417081 | 1417302 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 2016179 | 2016400 | + | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07151.14 | 0.75 | 3 | 927.0 | same-strand | Protein of unknown function (DUF1391) |
2 | PF01381.24 | 0.75 | 3 | 1515 | same-strand | Helix-turn-helix |
3 | PF13560.8 | 0.75 | 3 | 1515 | same-strand | Helix-turn-helix domain |