Result : P38382
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein translocase subunit SecE |
| NCBI Accession ID | BA000022.2 |
| Organism | Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Left | 926313 |
| Right | 926558 |
| Strand | - |
| Nucleotide Sequence | GTGGTTAAGAAGGAAGCGGTCAGAACCGACAGTACCGAAGACAATTCCGTGGACAATGTCCAGGCCCGGAGCAACTTCATTGCAGCCACCAAAGATGAGTTGGCAAAAGTGGTTTGGCCCTCCCGTCAACAGCTAATCAGCGAATCCGTAGCCGTGATTTTGATGGTTATCTTGGTTTCGACGGTTATCTACTTCGTTGATCAAATCTTTGGCTGGATTACCAAACAACCTTTCCTTTTCGGTTAA |
| Sequence | MVKKEAVRTDSTEDNSVDNVQARSNFIAATKDELAKVVWPSRQQLISESVAVILMVILVSTVIYFVDQIFGWITKQPFLFG |
| Source of smORF | Swiss-Prot |
| Function | Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}. |
| Pubmed ID | 7685084 8905231 |
| Domain | CDD:412402 |
| Functional Category | Others |
| Uniprot ID | P38382 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1160976 | 1161215 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 2 | 1127601 | 1127837 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 3 | 229928 | 230167 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 4 | 3032096 | 3032332 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 5 | 3305240 | 3305476 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 6 | 4857415 | 4857612 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 7 | 2613959 | 2614156 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019689.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 1.0 | 7 | 357 | same-strand | Ribosomal protein L19 |
| 2 | PF02357.21 | 1.0 | 7 | 0 | same-strand | Transcription termination factor nusG |
| 3 | PF00467.31 | 0.71 | 5 | 1 | same-strand | KOW motif |
| 4 | PF03946.16 | 1.0 | 7 | 646 | same-strand | Ribosomal protein L11, N-terminal domain |
| 5 | PF00298.21 | 1.0 | 7 | 646 | same-strand | Ribosomal protein L11, RNA binding domain |
| 6 | PF00687.23 | 1.0 | 7 | 1184 | same-strand | Ribosomal protein L1p/L10e family |
| 7 | PF00466.22 | 0.71 | 5 | 2146 | same-strand | Ribosomal protein L10 |
| 8 | PF00542.21 | 0.71 | 5 | 2794 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
| 9 | PF16320.7 | 0.71 | 5 | 2794 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
++ More..