Result : P38037
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translation initiation factor IF-1 |
| NCBI Accession ID | L23478.1 |
| Organism | Mycoplasma sp. |
| Left | 166 |
| Right | 438 |
| Strand | + |
| Nucleotide Sequence | ATGGAGAAGCTTACATATTATCAGGAGATAACATTTAATGGGAAAAAACAAAAAAGAAAAAAAGAAGAAGTTATTAAAATGACTGGTAAAGTAACCAAAATGCATTCAACAAAAAATTATGATGTTTTACTAGAAAATGATCAAGAAATTAAAGCTTATATTTCTGGAAAAATGTCATTACATAATATCAAACTTATTCCCGGTGATATGGTTGATGTGGAAATCAGTCCTTTTAATTTAACATTAGGTAGAATAGTTTTTCGCCATAAATAA |
| Sequence | MEKLTYYQEITFNGKKQKRKKEEVIKMTGKVTKMHSTKNYDVLLENDQEIKAYISGKMSLHNIKLIPGDMVDVEISPFNLTLGRIVFRHK |
| Source of smORF | Swiss-Prot |
| Function | One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex. {ECO:0000255|HAMAP-Rule:MF_00075}. |
| Pubmed ID | 8226662 |
| Domain | CDD:415806 |
| Functional Category | RNA-binding |
| Uniprot ID | P38037 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 188343 | 188579 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 2 | 4579316 | 4579537 | + | NZ_CP047650.1 | Xylophilus rhododendri |
| 3 | 2582 | 2800 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS991949.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00406.24 | 0.67 | 2 | 779.5 | same-strand | Adenylate kinase |
| 2 | PF13207.8 | 0.67 | 2 | 779.5 | same-strand | AAA domain |
| 3 | PF05191.16 | 0.67 | 2 | 779.5 | same-strand | Adenylate kinase, active site lid |
| 4 | PF13671.8 | 0.67 | 2 | 779.5 | same-strand | AAA domain |
| 5 | PF13238.8 | 0.67 | 2 | 779.5 | same-strand | AAA domain |
| 6 | PF03118.17 | 0.67 | 2 | 927.5 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
| 7 | PF01000.28 | 0.67 | 2 | 927.5 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
| 8 | PF01193.26 | 0.67 | 2 | 927.5 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |
++ More..