Protein Information |
Information Type | Description |
---|---|
Protein name | Translation initiation factor IF-1 |
NCBI Accession ID | L23478.1 |
Organism | Mycoplasma sp. |
Left | 166 |
Right | 438 |
Strand | + |
Nucleotide Sequence | ATGGAGAAGCTTACATATTATCAGGAGATAACATTTAATGGGAAAAAACAAAAAAGAAAAAAAGAAGAAGTTATTAAAATGACTGGTAAAGTAACCAAAATGCATTCAACAAAAAATTATGATGTTTTACTAGAAAATGATCAAGAAATTAAAGCTTATATTTCTGGAAAAATGTCATTACATAATATCAAACTTATTCCCGGTGATATGGTTGATGTGGAAATCAGTCCTTTTAATTTAACATTAGGTAGAATAGTTTTTCGCCATAAATAA |
Sequence | MEKLTYYQEITFNGKKQKRKKEEVIKMTGKVTKMHSTKNYDVLLENDQEIKAYISGKMSLHNIKLIPGDMVDVEISPFNLTLGRIVFRHK |
Source of smORF | Swiss-Prot |
Function | One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex. {ECO:0000255|HAMAP-Rule:MF_00075}. |
Pubmed ID | 8226662 |
Domain | CDD:415806 |
Functional Category | RNA-binding |
Uniprot ID | P38037 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 188343 | 188579 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
2 | 4579316 | 4579537 | + | NZ_CP047650.1 | Xylophilus rhododendri |
3 | 2582 | 2800 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00406.24 | 0.67 | 2 | 779.5 | same-strand | Adenylate kinase |
2 | PF13207.8 | 0.67 | 2 | 779.5 | same-strand | AAA domain |
3 | PF05191.16 | 0.67 | 2 | 779.5 | same-strand | Adenylate kinase, active site lid |
4 | PF13671.8 | 0.67 | 2 | 779.5 | same-strand | AAA domain |
5 | PF13238.8 | 0.67 | 2 | 779.5 | same-strand | AAA domain |
6 | PF03118.17 | 0.67 | 2 | 927.5 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
7 | PF01000.28 | 0.67 | 2 | 927.5 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
8 | PF01193.26 | 0.67 | 2 | 927.5 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |