Result : P37977
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein SCO4036 |
| NCBI Accession ID | L11648.1 |
| Organism | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Left | 385 |
| Right | 678 |
| Strand | + |
| Nucleotide Sequence | ATGATCCGCCATCTCGTGCTGTTCAAGCTGAACGACGGCGTCGGGCGCGACGAACCGCGCGTCCTGGCGGGCGTCGAGGCCTTCCGGGCGCTCGGCGGCCAGATCGAGGACCTCCGTTTCTGGGAGTGCGCCTGGAACATCAGCGACCGGCCCATCGCCTACGACTTCGCCATCAACTCGGCCGTGGACGACGCGGACGCGCTCAAGCGCTACCTCGAACATCCGGCGCACCAGGCGGGCGTCGCGCTGTGGCGCGAGTTCGCCACCTGGGTGATCGCCGACTACGAGTTCTAG |
| Sequence | MIRHLVLFKLNDGVGRDEPRVLAGVEAFRALGGQIEDLRFWECAWNISDRPIAYDFAINSAVDDADALKRYLEHPAHQAGVALWREFATWVIADYEF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl10022. Profile Description: Antibiotic biosynthesis monooxygenase. The function of this family is unknown, but it is upregulated in response to salt stress in Populus balsamifera. It is also found at the C-terminus of an fructose 1,6-bisphosphate aldolase from Hydrogenophilus thermoluteolus. Arthrobacter nicotinovorans ORF106 is found in the pA01 plasmid, which encodes genes for molybdopterin uptake and degradation of plant alkaloid nicotine. The structure of one has been solved and the domain forms an a/b barrel dimer. Although there is a clear duplication within the domain it is not obviously detectable in the sequence. |
| Pubmed ID | 7476207 12000953 |
| Domain | CDD:415830 |
| Functional Category | Others |
| Uniprot ID | P37977 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 77
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3514400 | 3514693 | + | NZ_CP015866.1 | Streptomyces parvulus |
| 2 | 3883443 | 3883736 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 3 | 5190468 | 5190761 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 4 | 4266552 | 4266845 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 5 | 4132886 | 4133179 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 6 | 4394793 | 4395086 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 7 | 3702725 | 3703018 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 8 | 4323434 | 4323736 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 9 | 10615095 | 10615388 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 10 | 5203953 | 5204246 | - | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 11 | 5133707 | 5134000 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 12 | 4649877 | 4650170 | + | NZ_CP022685.1 | Streptomyces formicae |
| 13 | 4403961 | 4404254 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 14 | 3951843 | 3952136 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 15 | 3828068 | 3828361 | + | NZ_CP023695.1 | Streptomyces alboniger |
| 16 | 4059331 | 4059624 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 17 | 4787357 | 4787650 | + | NZ_CP047020.1 | Streptomyces broussonetiae |
| 18 | 4817679 | 4817972 | + | NZ_CP023690.1 | Streptomyces spectabilis |
| 19 | 4653041 | 4653334 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 20 | 3867724 | 3868017 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 21 | 4478563 | 4478856 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 22 | 4669190 | 4669483 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 23 | 3968428 | 3968721 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 24 | 3616007 | 3616300 | + | NZ_AP023439.1 | Streptomyces tuirus |
| 25 | 3728536 | 3728829 | + | NZ_CP023407.1 | Streptomyces fungicidicus |
| 26 | 4962376 | 4962669 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 27 | 3004515 | 3004808 | + | NZ_CP032229.1 | Streptomyces seoulensis |
| 28 | 3462079 | 3462372 | + | NZ_CP022310.1 | Streptomyces calvus |
| 29 | 4886203 | 4886496 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 30 | 3960157 | 3960450 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 31 | 5237582 | 5237875 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 32 | 3710383 | 3710676 | - | NZ_CP031194.1 | Streptomyces paludis |
| 33 | 4257752 | 4258045 | + | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 34 | 3426755 | 3427048 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 35 | 3332608 | 3332901 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 36 | 3468158 | 3468451 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 37 | 4884602 | 4884895 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 38 | 4609891 | 4610184 | + | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 39 | 456299 | 456592 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 40 | 144233 | 144526 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 41 | 4735045 | 4735338 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 42 | 4553242 | 4553535 | - | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 43 | 4392675 | 4392968 | + | NZ_CP015098.1 | Streptomyces qaidamensis |
| 44 | 4126442 | 4126735 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 45 | 5261089 | 5261382 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 46 | 4472430 | 4472723 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 47 | 4515688 | 4515981 | - | NZ_CP026652.1 | Streptomyces dengpaensis |
| 48 | 5100817 | 5101110 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 49 | 4382940 | 4383233 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 50 | 4228233 | 4228526 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 51 | 4669624 | 4669917 | - | NZ_CP023691.1 | Streptomyces platensis |
| 52 | 4154791 | 4155084 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 53 | 406353 | 406646 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 54 | 4709541 | 4709834 | - | NZ_CP027306.1 | Streptomyces atratus |
| 55 | 3874697 | 3874990 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 56 | 3679286 | 3679579 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 57 | 4500852 | 4501154 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 58 | 4070644 | 4070937 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 59 | 3940812 | 3941105 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 60 | 4134468 | 4134761 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 61 | 4064807 | 4065100 | - | NZ_CP070242.1 | Streptomyces californicus |
| 62 | 4984118 | 4984411 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 63 | 4196359 | 4196652 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 64 | 4997755 | 4998066 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 65 | 4941362 | 4941655 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 66 | 3117037 | 3117330 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 67 | 5307020 | 5307313 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 68 | 3766929 | 3767222 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 69 | 3636609 | 3636902 | + | NZ_CP029043.1 | Streptomyces nigra |
| 70 | 3310850 | 3311143 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 71 | 4614509 | 4614802 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 72 | 3699384 | 3699677 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 73 | 5302833 | 5303126 | - | NZ_CP070326.1 | Streptomyces noursei |
| 74 | 4197990 | 4198283 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 75 | 3961642 | 3961935 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 76 | 3807340 | 3807633 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 77 | 3664856 | 3665152 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 78 | 4146375 | 4146668 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015866.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14437.8 | 0.79 | 61 | 708 | same-strand | MafB19-like deaminase |
| 2 | PF00383.25 | 0.79 | 61 | 708 | same-strand | Cytidine and deoxycytidylate deaminase zinc-binding region |
| 3 | PF04542.16 | 1.0 | 77 | 1188 | same-strand | Sigma-70 region 2 |
| 4 | PF04545.18 | 1.0 | 77 | 1188 | same-strand | Sigma-70, region 4 |
| 5 | PF04539.18 | 0.99 | 76 | 234.5 | same-strand | Sigma-70 region 3 |
| 6 | PF08281.14 | 1.0 | 77 | 1188 | same-strand | Sigma-70, region 4 |
| 7 | PF01047.24 | 0.84 | 65 | 3490 | same-strand | MarR family |
| 8 | PF12802.9 | 0.86 | 66 | 3489.5 | same-strand | MarR family |
| 9 | PF13463.8 | 0.78 | 60 | 3489.5 | same-strand | Winged helix DNA-binding domain |
++ More..