Protein Information |
Information Type | Description |
---|---|
Protein name | Protein CsbA |
NCBI Accession ID | M80473.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 380 |
Right | 610 |
Strand | + |
Nucleotide Sequence | TTGATTACAAAAGCCGTTTTTGCATTGTTTTTCCCTTTTATGCTTGTTGTTCTATTTACTAGAGTCACCTTTAATCATTATGTGGCGATCGCTTTAACAGCTGCATTGCTGTTTGCCTCTTATTTAAAAGGCTATACAGAAACGTATTTTATTGTAGGATTGGATGTTGTGTCTCTTGTGGCTGGCGGACTGTATATGGCCAAAAAAGCTGCAGAGAAAAAAGAAGAATAA |
Sequence | MITKAVFALFFPFMLVVLFTRVTFNHYVAIALTAALLFASYLKGYTETYFIVGLDVVSLVAGGLYMAKKAAEKKEE |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23972. Profile Description: Uncharacterized protein conserved in bacteria (DUF2198). This domain, found in various hypothetical bacterial proteins, has no known function. |
Pubmed ID | 1744042 1847907 9384377 |
Domain | CDD:420125 |
Functional Category | Others |
Uniprot ID | P37953 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3434654 | 3434884 | - | NZ_CP048852.1 | Bacillus tequilensis |
2 | 3477118 | 3477348 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 3615116 | 3615346 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
4 | 2641220 | 2641450 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 3471778 | 3472008 | - | NZ_CP033052.1 | Bacillus vallismortis |
6 | 3416771 | 3417001 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
7 | 3397166 | 3397396 | - | NZ_CP051464.1 | Bacillus mojavensis |
8 | 3776878 | 3777063 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
9 | 2201844 | 2202089 | + | NZ_CP017786.1 | Bacillus xiamenensis |
10 | 569664 | 569900 | + | NZ_CP011937.1 | Bacillus velezensis |
11 | 3475730 | 3475966 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
12 | 3158876 | 3159121 | - | NZ_CP011150.1 | Bacillus altitudinis |
13 | 2139443 | 2139688 | + | NZ_CP043404.1 | Bacillus safensis |
14 | 3582894 | 3583079 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
15 | 4006365 | 4006550 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
16 | 2484406 | 2484621 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
17 | 3871218 | 3871412 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
18 | 2753477 | 2753665 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
19 | 3109068 | 3109253 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
20 | 1980150 | 1980335 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
21 | 450994 | 451227 | + | NZ_CP016020.1 | Bacillus weihaiensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17760.3 | 1.0 | 21 | 2178 | same-strand | UvrA interaction domain |
2 | PF17755.3 | 1.0 | 21 | 2178 | same-strand | UvrA DNA-binding domain |
3 | PF00005.29 | 0.9 | 19 | 2178 | same-strand | ABC transporter |
4 | PF17757.3 | 1.0 | 21 | 185 | same-strand | UvrB interaction domain |
5 | PF12344.10 | 1.0 | 21 | 185 | same-strand | Ultra-violet resistance protein B |
6 | PF00271.33 | 1.0 | 21 | 185 | same-strand | Helicase conserved C-terminal domain |
7 | PF02151.21 | 1.0 | 21 | 185 | same-strand | UvrB/uvrC motif |
8 | PF17820.3 | 0.67 | 14 | 2800.5 | same-strand | PDZ domain |