Result : P37866
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Regulatory protein RecX |
| NCBI Accession ID | X95571.1 |
| Organism | Acidithiobacillus ferrooxidans (Thiobacillus ferrooxidans) |
| Left | 330 |
| Right | 602 |
| Strand | + |
| Nucleotide Sequence | ATGCTCACCCGTACCCGCGTGCGTCAGGGGCACGGGCCGTTGCGCTTGCGTCAGGACTTGCAGCGGGCAGGGGTGGAGGCTACCGCAGCCCTGGAGATTGACTGGTTGCAGCAAGCGCAAGCCGTCTGTCAGAAGCGTTTCGGCGACACGCCGCCGACGGACGCCAGAGATTATGCCCGGCGCGCTCGCTTTCTGGCGGGACGGGGATTTACCGGAGAGACGATTCGCCGAGTGCTGGGCGCCGGTAGAGAAAGGGATTTCTCTGCCGATTGA |
| Sequence | MLTRTRVRQGHGPLRLRQDLQRAGVEATAALEIDWLQQAQAVCQKRFGDTPPTDARDYARRARFLAGRGFTGETIRRVLGAGRERDFSAD |
| Source of smORF | Swiss-Prot |
| Function | Modulates RecA activity. {ECO:0000250}. |
| Pubmed ID | 9245807 8165147 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P37866 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2081572 | 2081844 | + | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 2 | 846894 | 847166 | + | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 3 | 1819814 | 1820092 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 4 | 1183038 | 1183328 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP018795.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00586.26 | 1.0 | 4 | 2711.5 | same-strand | AIR synthase related protein, N-terminal domain |
| 2 | PF02769.24 | 1.0 | 4 | 2711.5 | same-strand | AIR synthase related protein, C-terminal domain |
| 3 | PF04608.15 | 1.0 | 4 | 2233.5 | same-strand | Phosphatidylglycerophosphatase A |
| 4 | PF02464.19 | 1.0 | 4 | 1391.5 | same-strand | Competence-damaged protein |
| 5 | PF00154.23 | 1.0 | 4 | 181.0 | same-strand | recA bacterial DNA recombination protein |
| 6 | PF08423.13 | 1.0 | 4 | 181.0 | same-strand | Rad51 |
| 7 | PF01411.21 | 1.0 | 4 | 59.5 | same-strand | tRNA synthetases class II (A) |
| 8 | PF02272.21 | 1.0 | 4 | 59.5 | same-strand | DHHA1 domain |
| 9 | PF07973.16 | 1.0 | 4 | 59.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..