Result : P37771
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhfG |
| NCBI Accession ID | M32355.1 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Left | 179 |
| Right | 346 |
| Strand | + |
| Nucleotide Sequence | GTGAAGAAACTTACCGATAAACAAAAGTCACGCTTTTGGGAGCAACGGCGCAACGTTAACTTCCAGCAAAGCCGCCGTCTCGAAGGTATTGAGATCCCCTTAGTAACCCTGACTGCCGACGAAGCGCTGGTACGTCTTGACGAGCTTCGGAGGCACTATGAGCGATAA |
| Sequence | MKKLTDKQKSRFWEQRRNVNFQQSRRLEGIEIPLVTLTADEALVRLDELRRHYER |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23922. Profile Description: Protein of unknown function (DUF2559). hypothetical protein; Provisional |
| Pubmed ID | 2403545 11677609 |
| Domain | CDD:420093 |
| Functional Category | Others |
| Uniprot ID | P37771 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3620954 | 3621121 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 1470692 | 1470859 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 4383288 | 4383455 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 4 | 941594 | 941764 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 5 | 2792524 | 2792691 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 6 | 2397650 | 2397817 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 4702772 | 4702939 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 53179 | 53346 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 3460662 | 3460829 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 10 | 3452400 | 3452567 | - | NZ_AP014857.1 | Escherichia albertii |
| 11 | 1629395 | 1629562 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 3979571 | 3979738 | - | NZ_LR134340.1 | Escherichia marmotae |
| 13 | 348861 | 349028 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 14 | 3491453 | 3491620 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 15 | 4211487 | 4211654 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 16 | 476425 | 476592 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 17 | 2282088 | 2282255 | - | NZ_CP033744.1 | Citrobacter freundii |
| 18 | 415359 | 415529 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 19 | 4014972 | 4015139 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 20 | 4912012 | 4912182 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 21 | 3799233 | 3799400 | + | NZ_CP038469.1 | Citrobacter tructae |
| 22 | 2890746 | 2890913 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 23 | 4342790 | 4342957 | - | NC_015968.1 | Enterobacter soli |
| 24 | 5102420 | 5102590 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 25 | 397482 | 397649 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 26 | 396909 | 397076 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 27 | 3029728 | 3029895 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 28 | 413574 | 413741 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 29 | 434934 | 435101 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 30 | 3765935 | 3766105 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 31 | 3524351 | 3524521 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 32 | 1281680 | 1281847 | - | NZ_CP026047.1 | Raoultella planticola |
| 33 | 3918026 | 3918196 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 34 | 398829 | 398996 | + | NZ_CP050508.1 | Raoultella terrigena |
| 35 | 195748 | 195918 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 36 | 4085263 | 4085433 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 37 | 47085 | 47255 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 38 | 2732585 | 2732755 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 39 | 4484913 | 4485083 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 40 | 1151195 | 1151362 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 41 | 373995 | 374165 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 42 | 2087114 | 2087284 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 43 | 4894153 | 4894320 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 44 | 4203989 | 4204156 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 45 | 396617 | 396784 | + | NZ_CP041247.1 | Raoultella electrica |
| 46 | 3995425 | 3995595 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 47 | 406449 | 406616 | + | NZ_CP054254.1 | Klebsiella variicola |
| 48 | 452194 | 452361 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 49 | 1219064 | 1219234 | - | NZ_CP019706.1 | Pantoea alhagi |
| 50 | 443908 | 444078 | + | NZ_CP026377.1 | Mixta gaviniae |
| 51 | 369330 | 369500 | + | NZ_CP061511.1 | Mixta calida |
| 52 | 4195368 | 4195538 | + | NZ_CP028271.1 | Mixta intestinalis |
| 53 | 390352 | 390486 | + | NZ_LN907827.1 | Erwinia gerundensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00027.31 | 0.96 | 50 | 4644 | opposite-strand | Cyclic nucleotide-binding domain |
| 2 | PF13545.8 | 0.96 | 50 | 4644 | opposite-strand | Crp-like helix-turn-helix domain |
| 3 | PF00325.22 | 0.96 | 50 | 4644 | opposite-strand | Bacterial regulatory proteins, crp family |
| 4 | PF12805.9 | 0.96 | 50 | 2531 | opposite-strand | FUSC-like inner membrane protein yccS |
| 5 | PF13515.8 | 0.98 | 51 | 2512.5 | opposite-strand | Fusaric acid resistance protein-like |
| 6 | PF00202.23 | 1.0 | 52 | 1273 | same-strand | Aminotransferase class-III |
| 7 | PF00117.30 | 1.0 | 52 | 624 | same-strand | Glutamine amidotransferase class-I |
| 8 | PF02661.20 | 1.0 | 52 | -10 | same-strand | Fic/DOC family |
| 9 | PF00160.23 | 1.0 | 52 | 107 | same-strand | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD |
| 10 | PF07690.18 | 0.81 | 42 | 954 | opposite-strand | Major Facilitator Superfamily |
| 11 | PF07992.16 | 0.94 | 49 | 2474.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 12 | PF04324.17 | 0.94 | 49 | 2474.5 | opposite-strand | BFD-like [2Fe-2S] binding domain |
| 13 | PF00070.29 | 0.94 | 49 | 2474.5 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 14 | PF01077.24 | 0.94 | 49 | 2474.5 | opposite-strand | Nitrite and sulphite reductase 4Fe-4S domain |
| 15 | PF03460.19 | 0.94 | 49 | 2474.5 | opposite-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
| 16 | PF18267.3 | 0.94 | 49 | 2474.5 | opposite-strand | Rubredoxin NAD+ reductase C-terminal domain |
| 17 | PF13806.8 | 0.92 | 48 | 5012 | opposite-strand | Rieske-like [2Fe-2S] domain |
++ More..