Protein Information |
Information Type | Description |
---|---|
Protein name | Signal transduction protein PmrD (BasR post-transcriptional activator) (Polymyxin resistance protein PmrD) |
NCBI Accession ID | U02281.1 |
Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Left | 785 |
Right | 1042 |
Strand | + |
Nucleotide Sequence | ATGGAATGGTTGGTTAAGAAATCGCATTATGTCAAAAAGAGGGCGTGCCATGTTCTGGTGCTGTGCGATAGCGGCGGTTCGCTAAAAATGATCGCCGAGGCGAATTCCATGATATTACTGAGTCCCGGCGATATCCTGTCGCCTTTACAGGATGCGCAGTATTGTATTAATCGGGAAAAACACCAGACCTTAAAAATCGTTGATGCACGCTGTTATTCCTGCGACGAATGGCAGCGGTTGACGCGCAAGCCATCATGA |
Sequence | MEWLVKKSHYVKKRACHVLVLCDSGGSLKMIAEANSMILLSPGDILSPLQDAQYCINREKHQTLKIVDARCYSCDEWQRLTRKPS |
Source of smORF | Swiss-Prot |
Function | Interacts with phosphorylated BasR protein to mediate transcriptional induction of BasR-activated genes to induce polymyxin resistance. {ECO:0000269|Pubmed:10775270, ECO:0000269|Pubmed:12676988, ECO:0000269|Pubmed:15371344}. |
Pubmed ID | 8206837 15569938 11677609 9570402 10775270 12676988 15371344 |
Domain | CDD:420060 |
Functional Category | Others |
Uniprot ID | P37589 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2411317 | 2411574 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 384792 | 385040 | - | NZ_CP053416.1 | Salmonella bongori |
3 | 2241391 | 2241654 | + | NZ_CP045205.1 | Citrobacter telavivensis |
4 | 4603278 | 4603541 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
5 | 1066411 | 1066674 | - | NZ_CP033744.1 | Citrobacter freundii |
6 | 3999872 | 4000135 | + | NZ_CP044098.1 | Citrobacter portucalensis |
7 | 3103920 | 3104186 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
8 | 2373679 | 2373945 | - | NZ_AP014857.1 | Escherichia albertii |
9 | 2915528 | 2915794 | - | NZ_LR134340.1 | Escherichia marmotae |
10 | 4426456 | 4426722 | + | NZ_CP057657.1 | Escherichia fergusonii |
11 | 2373272 | 2373538 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
12 | 1348261 | 1348491 | + | NZ_CP061527.1 | Shigella dysenteriae |
13 | 2386000 | 2386209 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01370.23 | 0.92 | 11 | 3258.5 | opposite-strand | NAD dependent epimerase/dehydratase family |
2 | PF16363.7 | 0.92 | 11 | 3258.5 | opposite-strand | GDP-mannose 4,6 dehydratase |
3 | PF02911.20 | 0.92 | 11 | 3258.5 | opposite-strand | Formyl transferase, C-terminal domain |
4 | PF01522.23 | 1.0 | 12 | 2364 | opposite-strand | Polysaccharide deacetylase |
5 | PF02366.20 | 1.0 | 12 | 712 | opposite-strand | Dolichyl-phosphate-mannose-protein mannosyltransferase |
6 | PF13231.8 | 1.0 | 12 | 712 | opposite-strand | Dolichyl-phosphate-mannose-protein mannosyltransferase |
7 | PF00501.30 | 1.0 | 12 | 110 | same-strand | AMP-binding enzyme |
8 | PF13193.8 | 0.83 | 10 | 110 | same-strand | AMP-binding enzyme C-terminal domain |
9 | PF00378.22 | 1.0 | 12 | 2424 | same-strand | Enoyl-CoA hydratase/isomerase |
10 | PF12697.9 | 1.0 | 12 | 3296 | same-strand | Alpha/beta hydrolase family |
11 | PF12146.10 | 1.0 | 12 | 3296 | same-strand | Serine aminopeptidase, S33 |
12 | PF16582.7 | 1.0 | 12 | 4051 | same-strand | Middle domain of thiamine pyrophosphate |
13 | PF02775.23 | 0.83 | 10 | 4054 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
14 | PF00893.21 | 0.83 | 10 | 380 | opposite-strand | Small Multidrug Resistance protein |