Result : P37589

Protein Information

• Protein name: Signal transduction protein PmrD (BasR post-transcriptional activator) (Polymyxin resistance protein PmrD)
• NCBI Accession ID: U02281.1
• Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
• Left: 785
• Right: 1042
• Strand: +
• Nucleotide Sequence: ATGGAATGGTTGGTTAAGAAATCGCATTATGTCAAAAAGAGGGCGTGCCATGTTCTGGTGCTGTGCGATAGCGGCGGTTCGCTAAAAATGATCGCCGAGGCGAATTCCATGATATTACTGAGTCCCGGCGATATCCTGTCGCCTTTACAGGATGCGCAGTATTGTATTAATCGGGAAAAACACCAGACCTTAAAAATCGTTGATGCACGCTGTTATTCCTGCGACGAATGGCAGCGGTTGACGCGCAAGCCATCATGA
• Sequence: MEWLVKKSHYVKKRACHVLVLCDSGGSLKMIAEANSMILLSPGDILSPLQDAQYCINREKHQTLKIVDARCYSCDEWQRLTRKPS
• Source of smORF: Swiss-Prot
• Function: Interacts with phosphorylated BasR protein to mediate transcriptional induction of BasR-activated genes to induce polymyxin resistance. {ECO:0000269|Pubmed:10775270, ECO:0000269|Pubmed:12676988, ECO:0000269|Pubmed:15371344}.
• Pubmed ID: 8206837 15569938 11677609 9570402 10775270 12676988 15371344
• Domain: CDD:420060
• Functional Category: Others
• Uniprot ID: P37589
• ORF Length (Amino Acid): 85

Conservation Analysis

No. of Species: 12

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2411317	2411574	-	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2	384792	385040	-	NZ_CP053416.1	Salmonella bongori
3	2241391	2241654	+	NZ_CP045205.1	Citrobacter telavivensis
4	4603278	4603541	-	NZ_LT556085.1	Citrobacter amalonaticus
5	1066411	1066674	-	NZ_CP033744.1	Citrobacter freundii
6	3999872	4000135	+	NZ_CP044098.1	Citrobacter portucalensis
7	3103920	3104186	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
8	2373679	2373945	-	NZ_AP014857.1	Escherichia albertii
9	2915528	2915794	-	NZ_LR134340.1	Escherichia marmotae
10	4426456	4426722	+	NZ_CP057657.1	Escherichia fergusonii
11	2373272	2373538	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
12	1348261	1348491	+	NZ_CP061527.1	Shigella dysenteriae
13	2386000	2386209	-	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP045205.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01370.23	0.92	11	3258.5	opposite-strand	NAD dependent epimerase/dehydratase family
2	PF16363.7	0.92	11	3258.5	opposite-strand	GDP-mannose 4,6 dehydratase
3	PF02911.20	0.92	11	3258.5	opposite-strand	Formyl transferase, C-terminal domain
4	PF01522.23	1.0	12	2364	opposite-strand	Polysaccharide deacetylase
5	PF02366.20	1.0	12	712	opposite-strand	Dolichyl-phosphate-mannose-protein mannosyltransferase
6	PF13231.8	1.0	12	712	opposite-strand	Dolichyl-phosphate-mannose-protein mannosyltransferase
7	PF00501.30	1.0	12	110	same-strand	AMP-binding enzyme
8	PF13193.8	0.83	10	110	same-strand	AMP-binding enzyme C-terminal domain
9	PF00378.22	1.0	12	2424	same-strand	Enoyl-CoA hydratase/isomerase
10	PF12697.9	1.0	12	3296	same-strand	Alpha/beta hydrolase family
11	PF12146.10	1.0	12	3296	same-strand	Serine aminopeptidase, S33
12	PF16582.7	1.0	12	4051	same-strand	Middle domain of thiamine pyrophosphate
13	PF02775.23	0.83	10	4054	same-strand	Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
14	PF00893.21	0.83	10	380	opposite-strand	Small Multidrug Resistance protein