Result : P37558
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Spore protein YabP |
| NCBI Accession ID | D26185.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 131816 |
| Right | 132118 |
| Strand | + |
| Nucleotide Sequence | ATGAATTCATATTATGATCAAAAAGGTTCTTCGTCTGTTCCGGAACAGCATGATGTGACAATGAAAGGCCGGAAGCATTTAGATATTTCTGGGGTTAAGCATGTGGAGAGTTTTGATAACGAAGAATTCCTGCTGGAAACGGTGATGGGAATGCTCTCCGTCAGAGGCCAAAACCTGCAGATGAAAAATCTTGATGTGGAAAAAGGGATTGTTTCGATTAAAGGCAGGGTATTTGATTTAGTGTACTTAGACGAACAACAAGGGGATAAAGCTAAAGGGTTTTTTAGCAAGTTGTTTAAATGA |
| Sequence | MNSYYDQKGSSSVPEQHDVTMKGRKHLDISGVKHVESFDNEEFLLETVMGMLSVRGQNLQMKNLDVEKGIVSIKGRVFDLVYLDEQQGDKAKGFFSKLFK |
| Source of smORF | Swiss-Prot |
| Function | Required for sporulation. {ECO:0000269|Pubmed:10869437}. |
| Pubmed ID | 7584024 9384377 10869437 11283287 15231775 |
| Domain | CDD:414893 |
| Functional Category | Others |
| Uniprot ID | P37558 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 106
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 68216 | 68518 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 204054 | 204356 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 3861981 | 3862283 | - | NZ_CP011937.1 | Bacillus velezensis |
| 4 | 69260 | 69562 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 5 | 67914 | 68216 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 68098 | 68400 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 48482 | 48784 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 67907 | 68209 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 9 | 1941208 | 1941510 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 10 | 72992 | 73300 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 99619 | 99927 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 75717 | 76025 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 47281 | 47589 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 71600 | 71902 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 15 | 1477891 | 1478199 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 66746 | 67051 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 17 | 1560937 | 1561245 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 18 | 183221 | 183523 | + | NZ_CP053989.1 | Niallia circulans |
| 19 | 69096 | 69398 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 20 | 65530 | 65835 | + | NZ_LS483476.1 | Lederbergia lentus |
| 21 | 2513669 | 2513977 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 22 | 2499913 | 2500221 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 23 | 72731 | 73030 | + | NZ_CP012024.1 | Bacillus smithii |
| 24 | 1824817 | 1825122 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 25 | 2254210 | 2254515 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 26 | 2022116 | 2022415 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 27 | 3199472 | 3199777 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 28 | 66137 | 66445 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 29 | 70199 | 70504 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 30 | 119602 | 119892 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 31 | 4666481 | 4666786 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 32 | 548462 | 548767 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 33 | 416622 | 416927 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 34 | 62286 | 62528 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 35 | 3162862 | 3163167 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 36 | 66623 | 66868 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 37 | 2760223 | 2760468 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 38 | 206023 | 206268 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 39 | 2329486 | 2329731 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 40 | 4119628 | 4119939 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 41 | 62823 | 63065 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 42 | 2763063 | 2763305 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 43 | 62266 | 62574 | + | NC_011725.1 | Bacillus cereus B4264 |
| 44 | 5057230 | 5057472 | - | NZ_CP040336.1 | Bacillus luti |
| 45 | 62446 | 62688 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 46 | 62074 | 62316 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 47 | 62099 | 62341 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 48 | 1550650 | 1550892 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 49 | 57582 | 57890 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 50 | 92968 | 93279 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 51 | 77409 | 77651 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 52 | 68280 | 68582 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 53 | 74231 | 74512 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 54 | 1103702 | 1104007 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 55 | 236891 | 237139 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 56 | 66186 | 66488 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 57 | 81002 | 81304 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 58 | 1444468 | 1444767 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 59 | 83315 | 83560 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 60 | 1129393 | 1129641 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 61 | 2290383 | 2290685 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 62 | 78973 | 79278 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 63 | 80962 | 81267 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 64 | 123219 | 123518 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 65 | 2609183 | 2609482 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 66 | 2145831 | 2146133 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 67 | 2148026 | 2148268 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 68 | 82131 | 82373 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 69 | 76945 | 77187 | + | NZ_AP019400.1 | Cohnella abietis |
| 70 | 65653 | 65955 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 71 | 150882 | 151127 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 72 | 426109 | 426354 | - | NZ_CP026363.1 | Brevibacillus agri |
| 73 | 2336777 | 2337019 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 74 | 2231032 | 2231277 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 75 | 5279770 | 5280012 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 76 | 255572 | 255817 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 77 | 3924509 | 3924751 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 78 | 4297936 | 4298178 | + | NZ_CP033433.1 | Cohnella candidum |
| 79 | 5605090 | 5605335 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 80 | 79232 | 79480 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 81 | 7113206 | 7113448 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 82 | 58619 | 58864 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 83 | 848964 | 849206 | + | NZ_CP034437.1 | Paenibacillus albus |
| 84 | 5328859 | 5329101 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 85 | 1650700 | 1650945 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 86 | 2330048 | 2330293 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 87 | 63668 | 63910 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 88 | 3729641 | 3729883 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 89 | 3162503 | 3162745 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 90 | 1963734 | 1963976 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 91 | 51476 | 51718 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 92 | 1923667 | 1923909 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 93 | 51503 | 51745 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 94 | 3556122 | 3556364 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 95 | 1496973 | 1497215 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 96 | 232867 | 233109 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 97 | 51698 | 51940 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 98 | 4510438 | 4510680 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 99 | 218807 | 219049 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 100 | 3839070 | 3839315 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 101 | 701519 | 701761 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 102 | 51158 | 51400 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 103 | 8446276 | 8446518 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 104 | 4126305 | 4126562 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 105 | 880883 | 881128 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 106 | 966296 | 966574 | - | NZ_CP034248.1 | Paenibacillus lentus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF15714.7 | 0.85 | 90 | 3748.0 | same-strand | Stage V sporulation protein T C-terminal, transcription factor |
| 2 | PF04014.20 | 0.85 | 90 | 3748.0 | same-strand | Antidote-toxin recognition MazE, bacterial antitoxin |
| 3 | PF01943.19 | 0.86 | 91 | 1884 | same-strand | Polysaccharide biosynthesis protein |
| 4 | PF14667.8 | 0.92 | 97 | 1888 | same-strand | Polysaccharide biosynthesis C-terminal domain |
| 5 | PF03819.19 | 0.95 | 101 | 417 | same-strand | MazG nucleotide pyrophosphohydrolase domain |
| 6 | PF00590.22 | 0.95 | 101 | 417 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 7 | PF01479.27 | 0.97 | 103 | 136 | same-strand | S4 domain |
| 8 | PF09578.12 | 1.0 | 106 | -3.0 | same-strand | Spore cortex protein YabQ (Spore YabQ) |
| 9 | PF04977.17 | 0.98 | 104 | 627.0 | same-strand | Septum formation initiator |
| 10 | PF00575.25 | 0.98 | 104 | 1094.0 | same-strand | S1 RNA binding domain |
| 11 | PF19732.1 | 0.9 | 95 | 2091 | same-strand | Stage II sporulation protein E N-terminal |
| 12 | PF07228.14 | 0.89 | 94 | 2083.0 | same-strand | Stage II sporulation protein E (SpoIIE) |
++ More..