Result : P37553
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Anti-sigma-F factor Fin (Suppressor of recU and recB SubA) |
| NCBI Accession ID | D26185.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 123730 |
| Right | 123960 |
| Strand | + |
| Nucleotide Sequence | ATGGCTTTGCATTATTATTGTCGTCATTGCGGAGTGAAAGTAGGCAGTCTCGAATCTTCAATGGTATCGACAGACTCACTTGGATTTCAGCACTTAACAAATGAGGAAAGAAACGATATGATTTCTTATAAAGAAAATGGAGATGTCCATGTTTTGACGATATGTGAAGACTGCCAAGAGGCGCTTGACCGAAATCCGCATTACCACGAATATCACACATTTATTCAATAA |
| Sequence | MALHYYCRHCGVKVGSLESSMVSTDSLGFQHLTNEERNDMISYKENGDVHVLTICEDCQEALDRNPHYHEYHTFIQ |
| Source of smORF | Swiss-Prot |
| Function | An anti-sigma factor for sporulation specific sigma-F factor, by antagonizing sigma-F it allows the switch to sigma-G factor and progression to the late sporulation development stages (Pubmed:21037003). Might stabilize or process Holliday junction intermediates, although this may be due to polar effects on the downstream mfd gene (Pubmed:15317759). {ECO:0000269|Pubmed:15317759, ECO:0000269|Pubmed:21037003}. |
| Pubmed ID | 7584024 9384377 11810266 15317759 21037003 |
| Domain | CDD:402506 |
| Functional Category | Metal-binding |
| Uniprot ID | P37553 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 60130 | 60360 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 60012 | 60242 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 40393 | 40623 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 59821 | 60051 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 195968 | 196198 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1949365 | 1949595 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 59829 | 60059 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3870114 | 3870344 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 61199 | 61429 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1569136 | 1569366 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 39162 | 39392 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 1486077 | 1486307 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 64878 | 65108 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 91494 | 91724 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 67644 | 67874 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 4128071 | 4128301 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1090425 | 1090652 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 2337867 | 2338097 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 19 | 58254 | 58484 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 20 | 2751854 | 2752084 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 21 | 214405 | 214635 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 22 | 3171222 | 3171452 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 23 | 3191172 | 3191402 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 24 | 425008 | 425238 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 25 | 127687 | 127917 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 26 | 556920 | 557150 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 27 | 4658176 | 4658406 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 28 | 1540821 | 1541051 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 29 | 61889 | 62119 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 30 | 54304 | 54534 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 31 | 1833395 | 1833625 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 32 | 48726 | 48956 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 33 | 63264 | 63494 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 34 | 57860 | 58090 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 35 | 2505331 | 2505561 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 36 | 64002 | 64232 | + | NZ_CP012024.1 | Bacillus smithii |
| 37 | 2508312 | 2508542 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 38 | 65789 | 66016 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 39 | 71928 | 72158 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 40 | 172372 | 172602 | + | NZ_CP053989.1 | Niallia circulans |
| 41 | 60673 | 60903 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 42 | 248124 | 248354 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 43 | 1138197 | 1138427 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 44 | 57266 | 57496 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 45 | 69669 | 69899 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 46 | 70984 | 71211 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 47 | 2771649 | 2771879 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 48 | 70398 | 70628 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 49 | 5291735 | 5291965 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 50 | 5065502 | 5065726 | - | NZ_CP040336.1 | Bacillus luti |
| 51 | 5339121 | 5339351 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 52 | 4137061 | 4137291 | - | NZ_CP014167.1 | Paenibacillus yonginensis |
| 53 | 53848 | 54072 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 54 | 53819 | 54043 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 55 | 220008 | 220238 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 56 | 54079 | 54303 | + | NC_011725.1 | Bacillus cereus B4264 |
| 57 | 54573 | 54797 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 58 | 3740224 | 3740454 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 59 | 54194 | 54418 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 60 | 828768 | 828998 | + | NZ_CP034437.1 | Paenibacillus albus |
| 61 | 84571 | 84804 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 62 | 8456811 | 8457041 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 63 | 1507039 | 1507269 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 64 | 4500431 | 4500661 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 65 | 4284242 | 4284472 | + | NZ_CP033433.1 | Cohnella candidum |
| 66 | 2313357 | 2313590 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 67 | 2221157 | 2221387 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 68 | 3946227 | 3946457 | - | NC_019897.1 | Thermobacillus composti KWC4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04026.14 | 0.9 | 61 | 3974 | same-strand | SpoVG |
| 2 | PF00132.26 | 0.97 | 66 | 2412.0 | same-strand | Bacterial transferase hexapeptide (six repeats) |
| 3 | PF00483.25 | 0.97 | 66 | 2412.0 | same-strand | Nucleotidyl transferase |
| 4 | PF14602.8 | 0.97 | 66 | 2412.0 | same-strand | Hexapeptide repeat of succinyl-transferase |
| 5 | PF13793.8 | 0.85 | 58 | 1447.0 | same-strand | N-terminal domain of ribose phosphate pyrophosphokinase |
| 6 | PF14693.8 | 0.87 | 59 | 763 | same-strand | Ribosomal protein TL5, C-terminal domain |
| 7 | PF01386.21 | 0.87 | 59 | 763 | same-strand | Ribosomal L25p family |
| 8 | PF01195.21 | 1.0 | 68 | 77.0 | same-strand | Peptidyl-tRNA hydrolase |
| 9 | PF02559.18 | 1.0 | 68 | 90.5 | same-strand | CarD-like/TRCF domain |
| 10 | PF17757.3 | 1.0 | 68 | 90.5 | same-strand | UvrB interaction domain |
| 11 | PF03461.17 | 1.0 | 68 | 90.5 | same-strand | TRCF domain |
| 12 | PF00271.33 | 1.0 | 68 | 90.5 | same-strand | Helicase conserved C-terminal domain |
| 13 | PF00270.31 | 0.99 | 67 | 90 | same-strand | DEAD/DEAH box helicase |
| 14 | PF04851.17 | 0.99 | 67 | 90 | same-strand | Type III restriction enzyme, res subunit |
| 15 | PF15714.7 | 0.96 | 65 | 3832 | same-strand | Stage V sporulation protein T C-terminal, transcription factor |
| 16 | PF04014.20 | 0.96 | 65 | 3832 | same-strand | Antidote-toxin recognition MazE, bacterial antitoxin |
| 17 | PF01943.19 | 0.91 | 62 | 4628.5 | same-strand | Polysaccharide biosynthesis protein |
| 18 | PF14667.8 | 0.93 | 63 | 4632 | same-strand | Polysaccharide biosynthesis C-terminal domain |
| 19 | PF03819.19 | 0.85 | 58 | 6201.0 | same-strand | MazG nucleotide pyrophosphohydrolase domain |
| 20 | PF00590.22 | 0.85 | 58 | 6201.0 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 21 | PF01479.27 | 0.69 | 47 | 7631 | same-strand | S4 domain |
++ More..